(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE255

ALDEN1_2.PE255       Location/Qualifiers
FT   CDS_pept        complement(286498..287271)
FT                   /locus_tag="Alide_0259"
FT                   /gene_family="HOG000265759" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.18.1.2"
FT                   /codon_start="1"
FT                   /EC_number="1.18.1.2"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0153 ferredoxin--NADP(+) reductase;
FT                   PFAM: oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   Oxidoreductase FAD-binding domain protein"
FT                   /db_xref="GI:319760993"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="GeneID:10102282"
FT                   /translation="MSAFHEERVLSVHHWTDRLFSFTTTRDPALRFSNGHFTMIGLKVN
FT                   DKPLLRAYSIVSANYEEHLEFLSIKVPDGPLTSRLQHIKVGDSIIVGKKPTGTLLIDYL
FT                   LPAKRLYLMSTGTGLAPFLSVIRDPETYEKFEEVVLIHGVRQVAELAYHDYITRELPKH
FT                   EFLGELVTKQLKYYPTVTREPFRNQGRIPNLIESGKLFTDLGVPPLDPLTDRAMLCGSP
FT                   EMLASLKTILEHRDFEEGNTTRPGDFVIERAFVEK"
FT                   /product="ferredoxin--nadp(+) reductase"
FT                   /protein_id="YP_004124930.1"
     atgagcgcat tccacgaaga gcgtgtcctg tcggtgcacc actggaccga ccgcctgttt        60
     tccttcacca ccacgcgcga cccggcgctg cggttctcca acggccactt caccatgatc       120
     gggctgaagg tcaacgacaa gccgctgctg cgcgcctaca gcatcgtcag cgccaactac       180
     gaggagcacc tggagttcct gtccatcaag gtgccggacg gcccgctgac ctcgcgcctg       240
     cagcacatca aggtgggcga ctccatcatc gtgggcaaga agcccacggg cacgctgctc       300
     atcgactacc tgctgccggc caagcgcctg tacctgatgt ccacgggcac gggcctggcg       360
     ccgttcctga gcgtgatccg cgaccccgag acctacgaga agttcgagga agtggtcctg       420
     atccacggcg tgcgccaggt ggccgagctg gcctaccacg actacatcac ccgcgagctg       480
     cccaagcacg agttcctggg cgagctggtc accaagcagc tcaagtacta ccccacggtc       540
     actcgcgagc ccttccgcaa ccagggccgc atccccaatc tgatcgaaag cggcaagctg       600
     ttcaccgacc tgggcgtgcc gccgctcgac ccgctcaccg accgcgcgat gctctgtggc       660
     agcccggaga tgctggcatc gctcaagacc atcctggagc accgcgactt cgaggaaggc       720
     aacaccacgc gaccgggcga cttcgtgatc gagcgggcgt tcgttgaaaa gtaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page