(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE256

ALDEN1_2.PE256       Location/Qualifiers
FT   CDS_pept        287464..288660
FT                   /locus_tag="Alide_0260"
FT                   /gene_family="HOG000228861" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /codon_start="1"
FT                   /product="extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   dia:Dtpsy_0172 extracellular ligand-binding receptor"
FT                   /db_xref="GI:319760994"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="GeneID:10102283"
FT                   /translation="MHKRFTAFVAALAWGLGAAQAQDVYTIGEINSYKAQPAFLEPYKK
FT                   GMELAVAQVNATGGVGGKKLRLVTRDDNGNPGDAVRAAEELIAREKVDVLMGSFLSHVG
FT                   LALTDFAQQKKRFFLAAEPLTDKIVWENGNRYTFRLRPSTYMQVAMLVPEAAAMKKKRW
FT                   AIVYPNYEYGQSAVATFKQLLKAAQPDVEFVAEQAAPLGKVDAGSVVQALADAKPDAIF
FT                   NVLFAADLAKFVREGNTRGLFAGKGVVSLLSGEPEYLDTLKGEAPEGWIVTGYPWYAIH
FT                   TPDHEAFLDAYKKRFKDYPRAGSVVGYNAIQSIAAGLKKAGSADTEKLIAAFRGLEVRT
FT                   PFGPITYRAQDHQSTMGAYVGKTGLYGGKGVMVDFKYMDGAKFQPSDAEVKKLRPAAP"
FT                   /protein_id="YP_004124931.1"
     ATGCACAAAC GCTTCACTGC CTTCGTGGCG GCACTGGCCT GGGGCCTGGG CGCGGCCCAG        60
     GCGCAGGACG TCTACACCAT CGGCGAGATC AACAGCTACA AGGCCCAGCC CGCGTTCCTG       120
     GAACCCTACA AGAAGGGCAT GGAGCTCGCG GTGGCCCAGG TCAACGCCAC CGGCGGCGTG       180
     GGCGGCAAGA AGCTGCGCCT GGTCACGCGC GACGACAACG GCAACCCCGG CGACGCCGTG       240
     CGCGCGGCAG AGGAGCTGAT CGCGCGCGAG AAGGTGGATG TGCTCATGGG CAGCTTTCTG       300
     TCGCACGTGG GCTTGGCGCT GACCGACTTC GCGCAGCAGA AGAAGCGCTT CTTCCTGGCC       360
     GCCGAGCCGC TCACCGACAA GATCGTGTGG GAGAACGGCA ACCGCTACAC CTTTCGCCTG       420
     CGCCCCTCCA CCTACATGCA GGTGGCCATG CTGGTGCCCG AGGCCGCGGC CATGAAGAAG       480
     AAGCGCTGGG CCATCGTCTA TCCCAACTAC GAGTACGGCC AGTCGGCCGT GGCCACGTTC       540
     AAGCAATTGC TCAAGGCCGC GCAGCCCGAC GTGGAGTTCG TCGCCGAGCA GGCCGCGCCG       600
     CTGGGCAAGG TGGACGCGGG CAGCGTGGTG CAGGCGCTGG CGGATGCCAA GCCCGACGCG       660
     ATCTTCAACG TGCTGTTCGC GGCGGATCTG GCCAAATTCG TGCGCGAGGG CAACACGCGC       720
     GGCCTGTTCG CGGGCAAGGG CGTGGTGAGC CTGCTGTCGG GTGAGCCCGA GTACCTGGAC       780
     ACGCTCAAGG GCGAGGCGCC CGAGGGCTGG ATCGTCACCG GCTACCCCTG GTACGCCATC       840
     CACACGCCCG ACCACGAGGC CTTCCTGGAC GCCTACAAGA AGCGCTTCAA GGACTACCCG       900
     CGCGCGGGCT CGGTCGTGGG CTACAACGCC ATCCAGTCGA TTGCCGCGGG CTTGAAGAAG       960
     GCCGGCAGCG CCGACACCGA GAAGCTCATC GCCGCCTTCA GGGGCCTGGA GGTGCGCACG      1020
     CCCTTCGGCC CCATCACCTA CCGCGCGCAG GACCACCAGT CCACCATGGG CGCCTACGTG      1080
     GGCAAGACGG GCCTGTACGG CGGCAAGGGC GTGATGGTGG ACTTCAAGTA CATGGACGGC      1140
     GCGAAGTTCC AGCCGTCCGA CGCCGAGGTG AAGAAGCTGC GCCCGGCCGC GCCCTGA         1197
//

If you have problems or comments...

PBIL Back to PBIL home page