(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE259

ALDEN1_2.PE259       Location/Qualifiers
FT   CDS_pept        292258..295158
FT                   /locus_tag="Alide_0263"
FT                   /gene_family="HOG000131249" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00112"
FT                   /codon_start="1"
FT                   /product="peptidase c1a papain"
FT                   /transl_table="11"
FT                   /note="KEGG: kpe:KPK_1160 peptidoglycan binding
FT                   domain/papain family cysteine protease; PFAM: peptidase C1A
FT                   papain; SMART: peptidase C1A papain"
FT                   /db_xref="GI:319760997"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="GeneID:10102286"
FT                   /translation="MPTYLLRQGSQDPLVARLRKVLVAELGDAAESYPQLDKGGATFDA
FT                   MLDAALRCWQNGRGLIADGIVGPCNLLALGLADWPPLDCELNTDSVHALFPATKPVNIA
FT                   RYLGYVTAALRAVGLLGRDMVLAALGTIRAETEGFVPISEFQSKYNTAPGGAPFALYDG
FT                   RLGNRRGEGAMFRGRGFVQLTGRSNYETYGAKLGLDLAATPELANAPEVAALLLALFLD
FT                   AHRDAMQACLAAGDLKGARRLVNGGSHGLANFQSVFELAQNALPAAAAPAAPPPVGRRA
FT                   GGRAGATATRKRAPRGQAAQEPASGRTLNAQADAPDLRDRPYTPPPASLQPEWPTTEAV
FT                   TQWLPAYAKAGLVLNQGQEGACTGFGLAGVVNYLRWVRAGLPKAMVSVSPRMLYNMARR
FT                   YDEYAGENYEGSSCRGAIKGWFNHGVCLEDDWPYQAAAQLPPHFGFAERARGTTVGVYY
FT                   RIDTSSISDLQAAIMHVGAIFVSSYVHAGWQEVATSTLPKGHASLPVIAFDGIPRRDAG
FT                   HAYALVGYNDRGFVLQNSWGPGWGAHGFAVLSYEDWLQHAMDAWVVALGVPGLIGGGRN
FT                   VPLAAGGRAAAGGGWSESQTLDHVISVGNDGRMSRYLTTDERTRNLSYQVSVLPDQWFR
FT                   AQPPEGKKRLILYVHGGLNSEADGIKRARSLGRLFEANGCYPLFVVWHTGLLESIRYYL
FT                   DDWRAGRPAAAGVKEWATERTDALIESTIGRTVVRALWSEMKENAGYAWQATRAGDLLV
FT                   RALGELRALWGDQLEVHLMGHSAGSIWLGHMLTWMAKAQATSGAPGLREAVAGVHLYAP
FT                   ACTVAFANQHFADKALLGRTHVAVLSDDRERDDNTAYIYRKSLLYLVSNALEQDRRTPL
FT                   LGLERALTGRNDQNTWDGASTTGETLAIWRRAAAEARLASRLKIVSEDKVLTATPDVRI
FT                   PASHGAFDNDVAIVGATLERICGQPLREPPRDLRGY"
FT                   /protein_id="YP_004124934.1"
     ATGCCGACCT ATCTGTTGCG CCAGGGGAGT CAGGATCCAT TGGTCGCCAG GCTGCGCAAG        60
     GTGCTGGTGG CCGAGCTGGG GGACGCGGCG GAGAGCTACC CGCAGCTGGA CAAGGGTGGC       120
     GCGACCTTCG ATGCCATGCT GGACGCCGCG CTGCGCTGCT GGCAGAACGG CCGGGGGCTG       180
     ATCGCCGACG GTATCGTGGG GCCGTGCAAC CTGCTGGCGC TGGGGCTGGC CGACTGGCCG       240
     CCGCTGGACT GTGAGCTCAA CACGGACAGC GTCCACGCCC TGTTTCCCGC AACCAAGCCG       300
     GTCAACATCG CGCGCTATCT GGGCTATGTG ACGGCCGCCC TGCGCGCCGT CGGCCTGCTC       360
     GGCCGCGACA TGGTGCTGGC CGCGCTGGGC ACCATACGCG CCGAGACCGA GGGCTTCGTT       420
     CCGATTTCCG AATTCCAATC CAAGTACAAC ACCGCTCCCG GAGGAGCACC CTTTGCGCTC       480
     TACGACGGGC GGCTGGGCAA CCGCCGGGGC GAGGGCGCCA TGTTCCGCGG GCGCGGGTTC       540
     GTGCAACTCA CGGGGCGCAG CAACTACGAG ACCTATGGCG CCAAGCTGGG GCTGGACCTG       600
     GCCGCCACGC CGGAGTTGGC CAATGCCCCC GAGGTGGCGG CGCTGCTGCT GGCGCTGTTT       660
     CTGGATGCGC ATCGCGACGC GATGCAGGCT TGCCTGGCCG CGGGGGACCT CAAGGGCGCG       720
     CGCCGCCTTG TCAACGGCGG CTCACATGGG CTTGCCAACT TCCAGAGCGT GTTCGAACTG       780
     GCGCAGAACG CATTGCCGGC CGCCGCCGCG CCAGCAGCGC CGCCACCCGT GGGCAGGCGC       840
     GCCGGGGGCC GGGCCGGCGC CACCGCCACG AGAAAGCGCG CGCCGCGCGG CCAGGCGGCG       900
     CAGGAGCCCG CCAGCGGGCG CACGCTCAAT GCGCAGGCCG ACGCGCCCGA CCTGCGCGAC       960
     CGCCCCTACA CGCCGCCGCC CGCCAGCCTG CAGCCCGAAT GGCCCACGAC CGAGGCGGTG      1020
     ACCCAATGGC TGCCGGCCTA TGCCAAGGCG GGCCTAGTGC TGAATCAGGG GCAGGAGGGC      1080
     GCGTGCACCG GCTTTGGCCT GGCGGGCGTG GTCAACTACC TGCGCTGGGT GCGCGCAGGC      1140
     TTGCCCAAGG CCATGGTGTC GGTCAGCCCG CGCATGCTCT ACAACATGGC GCGGCGCTAT      1200
     GACGAGTACG CGGGCGAGAA CTACGAGGGC TCCAGCTGCC GTGGCGCCAT CAAGGGCTGG      1260
     TTCAACCATG GCGTCTGCCT GGAGGACGAC TGGCCGTACC AGGCCGCAGC GCAGCTACCC      1320
     CCTCACTTCG GCTTTGCCGA GCGTGCCCGC GGCACCACCG TGGGCGTGTA CTACCGTATC      1380
     GACACCAGCA GCATCTCCGA CCTGCAGGCG GCGATCATGC ATGTGGGCGC CATCTTCGTG      1440
     TCCAGCTACG TGCATGCTGG CTGGCAGGAA GTGGCGACCA GCACGCTTCC CAAGGGCCAT      1500
     GCCAGCCTGC CGGTGATCGC CTTCGACGGC ATTCCCCGGC GCGATGCGGG GCACGCCTAC      1560
     GCGCTGGTGG GCTACAACGA TCGCGGCTTC GTGCTGCAGA ACTCCTGGGG TCCCGGATGG      1620
     GGCGCGCATG GCTTTGCCGT GCTGAGCTAC GAGGACTGGC TGCAGCATGC GATGGATGCC      1680
     TGGGTGGTGG CGCTCGGCGT GCCTGGCCTG ATCGGTGGCG GGCGCAATGT GCCGCTGGCC      1740
     GCAGGGGGGC GGGCGGCCGC GGGCGGCGGC TGGTCCGAGA GCCAGACCCT CGACCATGTG      1800
     ATCTCGGTGG GCAACGACGG CCGCATGAGC CGCTACCTGA CCACCGACGA ACGTACGCGC      1860
     AATCTCTCCT ACCAGGTCAG CGTGCTGCCC GACCAGTGGT TCCGCGCGCA GCCGCCAGAG      1920
     GGCAAGAAGC GCCTGATCCT GTACGTGCAT GGCGGGCTCA ACAGCGAGGC CGACGGCATC      1980
     AAGCGCGCGC GCTCCCTGGG GCGGCTGTTC GAGGCCAATG GCTGCTATCC GCTGTTCGTG      2040
     GTCTGGCACA CCGGGCTGCT CGAAAGCATC CGTTACTACC TGGACGACTG GCGCGCGGGG      2100
     CGCCCGGCCG CCGCAGGCGT GAAGGAATGG GCGACCGAGC GCACCGACGC GCTGATCGAG      2160
     TCCACGATAG GCCGCACCGT GGTGCGCGCG CTGTGGAGCG AGATGAAGGA GAACGCCGGC      2220
     TATGCCTGGC AGGCCACGCG CGCGGGCGAC CTGCTGGTGC GTGCCCTGGG CGAGTTGAGA      2280
     GCGCTGTGGG GCGACCAACT GGAGGTGCAC CTGATGGGGC ACTCGGCGGG CAGCATCTGG      2340
     CTGGGGCACA TGCTGACCTG GATGGCCAAG GCGCAGGCCA CCTCTGGCGC GCCCGGCCTG      2400
     CGCGAGGCGG TGGCCGGCGT CCATTTGTAC GCGCCAGCCT GCACGGTGGC CTTTGCCAAC      2460
     CAGCATTTCG CCGACAAGGC GCTGCTGGGC AGAACCCATG TCGCCGTCCT GAGCGATGAC      2520
     CGGGAGCGCG ACGACAACAC CGCCTATATC TACCGTAAAT CCTTGCTGTA CCTGGTATCC      2580
     AACGCGCTGG AGCAGGACCG GCGCACGCCC CTTCTGGGGC TGGAGCGCGC CCTTACCGGC      2640
     CGCAACGACC AGAACACCTG GGACGGAGCC TCCACCACGG GCGAGACCCT GGCCATCTGG      2700
     CGCCGCGCCG CGGCCGAGGC GCGGCTCGCC TCGCGCCTGA AGATCGTGAG TGAGGACAAA      2760
     GTGCTCACGG CCACGCCCGA TGTGCGCATC CCCGCCAGCC ATGGCGCGTT CGACAACGAC      2820
     GTGGCCATCG TCGGCGCCAC GCTGGAGCGC ATCTGCGGCC AGCCGCTGCG CGAGCCTCCG      2880
     CGCGACCTGC GGGGTTACTG A                                                2901
//

If you have problems or comments...

PBIL Back to PBIL home page