(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE260

ALDEN1_2.PE260       Location/Qualifiers
FT   CDS_pept        complement(297101..298636)
FT                   /locus_tag="Alide_0266"
FT                   /gene_family="HOG000246698" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /codon_start="1"
FT                   /product="mg chelatase, subunit chli"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: dia:Dtpsy_0179 Mg chelatase,
FT                   subunit ChlI; SMART: AAA ATPase"
FT                   /db_xref="GI:319760998"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="GeneID:10102289"
FT                   /translation="MSLALVQSRALLGLQASAVTVEVHLANGLPSFALVGLADVEVKEA
FT                   RERVRSALQNAGLEFPTNKKITVNLAPADLPKDSGRYDLPIALGILAASGQIAAERLAG
FT                   WEFAGELSLSGLLRPVRGALATSLALRAEQPPVRMVLPPGSAEEAALVPGAEIYRARHL
FT                   LDVVRQFLPAAAPPQEDDDGWQRLAPAAPAVHTSSPDLADVKGQAAAKRALEIAAAGGH
FT                   GLLLVGPPGSGKSMLAQRFASLLPPMSVEQALESAAIASLAGRFTGAQWMQRVTASPHH
FT                   SCSAVALVGGGSPPRPGEISLAHEGVLFLDEFPEFARSALEALREPLETGLITISRAAQ
FT                   RAEFPARFQLVAAMNPCPCGFAGSAQRACRCTPDQVARYQGKLSGPLLDRIDLHVEVPH
FT                   LPAEDLLNAPAGEASSAVRERVARAHALALARQGTPNQALQGQQLDRMAALDEAAARFL
FT                   QTAAARMGWSARGTHRALKVARTIADLAASEQVGMAHVAEAVQYRRVLRGTQA"
FT                   /protein_id="YP_004124935.1"
     atgagtcttg ctttggtgca aagccgcgcc ctgctgggcc tgcaggcaag cgccgtcacc        60
     gtggaggtgc atctggccaa cggcctgccg agcttcgcgc tcgtgggcct ggccgacgtg       120
     gaggtgaagg aggcgcgcga gcgcgtgcgc tcggccctgc agaacgcggg gctggagttc       180
     cccaccaaca agaagatcac cgtgaacctg gcgccggccg acctgcccaa ggactcgggg       240
     cgctacgacc tgcccatcgc cctgggtatc ctggccgcca gcgggcagat cgccgctgaa       300
     cgcctggcgg gctgggagtt cgcgggcgag ctatcgctgt cgggcctgct gcggcccgtg       360
     cgcggcgcgc tggccaccag cctggcgctg cgcgccgagc agccgcccgt gcgcatggtg       420
     ctgccgccgg gcagcgccga ggaggccgcc ctggtgcccg gcgccgagat ctaccgcgcg       480
     cgccacctgc tggacgtggt gcgccagttc ctgcccgcag ccgcgccgcc gcaggaagac       540
     gacgacggct ggcagcgcct ggcgccggcc gcgcccgccg tccacaccag cagccccgac       600
     cttgctgacg tgaagggcca ggccgccgcc aagcgcgcac tggaaatcgc cgcagccggc       660
     ggccatgggc tgctgctcgt gggccctccg ggctcgggca aatccatgct ggcgcagcgc       720
     ttcgccagcc tgctgccgcc gatgagcgtg gagcaggcgc tggagagcgc ggccatcgcc       780
     agcctggccg ggcgcttcac gggcgcgcag tggatgcagc gcgtcacggc cagcccgcac       840
     cacagctgca gcgccgtcgc actggtgggc gggggatcgc cgccgcggcc cggcgagatc       900
     tcgctggcgc acgagggagt cctgttcctc gacgagttcc ccgaattcgc acgcagcgcc       960
     ctggaggccc tgcgcgagcc gctggagacc ggcctcatca ccatctcgcg cgcggcgcag      1020
     cgcgccgagt tcccggcgcg ctttcagctc gtcgccgcca tgaacccctg cccctgcggc      1080
     ttcgcgggct ccgcccagcg cgcctgccgc tgcacgccgg accaggtggc gcgctaccag      1140
     ggcaagctga gcggcccgtt gctcgaccgc atagacctgc acgtggaggt gccgcacctg      1200
     cccgccgagg acctgctgaa cgcccccgcc ggcgaggcga gcagcgccgt gcgcgagcgc      1260
     gtggcccgcg cccacgcgct ggccctggcg cgccagggca cgcccaacca agcactgcaa      1320
     ggccagcagc tcgaccgcat ggccgcgctg gacgaggccg cagcgcgctt cctgcagacc      1380
     gccgccgcgc gcatgggctg gtcggcgcgc ggcacgcacc gcgcgctgaa ggtggcacgc      1440
     accatcgccg acctggcggc gtcggagcag gtgggcatgg cccatgtggc cgaggcggtg      1500
     cagtacaggc gggtgctgcg cggcacgcag gcctga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page