(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE261

ALDEN1_2.PE261       Location/Qualifiers
FT   CDS_pept        298775..299506
FT                   /locus_tag="Alide_0267"
FT                   /gene_family="HOG000286927" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09694"
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein chp02001"
FT                   /transl_table="11"
FT                   /note="PFAM: Conserved hypothetical protein CHP02001; KEGG:
FT                   dia:Dtpsy_0180 hypothetical protein"
FT                   /db_xref="GI:319760999"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="GeneID:10102290"
FT                   /translation="MSHASLKSLSLALVAAAMPVLASAELTANVALTSNYKFRGQDQDV
FT                   HRIKAVSPAIQGGFDYTFGESGFYLGNWNSSVDWLQGNSIESDLYGGYRFKAGALDLDL
FT                   GALAYIYPGNTAGNTTELYGAATWGPLTAKYSHTVSKDYFGWAGAKTSGLRGRNTGYLN
FT                   LAFAREVAPSVTLKAAVGYTRFAGDIRDLGVPSYVDYSVGGAYDFGAGLSLSAAVAGAN
FT                   KKGFFGDANKARLIVTLSKTL"
FT                   /protein_id="YP_004124936.1"
     ATGTCCCATG CATCCCTGAA GTCCCTGAGC CTGGCCCTGG TGGCCGCGGC CATGCCCGTG        60
     CTGGCGAGCG CCGAGCTGAC GGCCAACGTG GCGCTGACCA GCAATTACAA GTTCCGCGGC       120
     CAGGACCAGG ACGTGCACCG CATCAAGGCG GTGAGCCCGG CCATCCAGGG CGGCTTCGAC       180
     TACACGTTCG GCGAGAGCGG CTTCTACCTG GGCAACTGGA ATTCCAGCGT GGACTGGCTG       240
     CAGGGCAACT CGATCGAGTC CGACCTGTAC GGCGGCTACC GCTTCAAGGC CGGCGCGCTG       300
     GACCTGGACC TGGGCGCGCT CGCCTACATC TACCCCGGCA ACACCGCCGG CAACACCACC       360
     GAGCTGTACG GCGCGGCCAC CTGGGGGCCG CTCACGGCCA AGTACTCGCA CACCGTGTCC       420
     AAGGACTATT TCGGCTGGGC CGGCGCCAAG ACGTCGGGCC TGCGCGGTCG CAACACGGGC       480
     TATCTGAACC TGGCGTTCGC CAGGGAGGTG GCGCCCAGCG TCACGCTCAA GGCGGCCGTG       540
     GGCTACACGC GCTTCGCTGG CGACATCCGC GACCTGGGCG TGCCCAGCTA CGTGGATTAC       600
     AGCGTGGGCG GGGCCTACGA CTTCGGCGCC GGCCTATCGC TGTCCGCAGC CGTCGCGGGC       660
     GCCAACAAGA AGGGGTTCTT CGGCGACGCC AACAAGGCGC GCCTGATCGT CACCCTGTCC       720
     AAGACTCTGT AA                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page