(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE262

ALDEN1_2.PE262       Location/Qualifiers
FT   CDS_pept        299526..299864
FT                   /locus_tag="Alide_0268"
FT                   /gene_family="HOG000017847" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /codon_start="1"
FT                   /product="nitrogen regulatory protein p-ii"
FT                   /transl_table="11"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   aav:Aave_0233 nitrogen regulatory protein P-II"
FT                   /db_xref="GI:319761000"
FT                   /db_xref="GO:0030234"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="GeneID:10102291"
FT                   /translation="MKMITAIIKPFKLDEVREALSDVGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVADDLAERVIEAIEGAARTGKIGDGKIFVADLEQVVRIRT
FT                   GETGGQAL"
FT                   /protein_id="YP_004124937.1"
     ATGAAAATGA TCACCGCCAT CATCAAACCC TTCAAGCTCG ACGAGGTGCG CGAGGCGCTG        60
     TCGGACGTCG GCGTGCAGGG CATCACCGTG ACCGAGGTGA AGGGCTTCGG CCGCCAGAAG       120
     GGCCACACCG AGCTGTACCG CGGCGCCGAG TACGTCGTGG ACTTCCTGCC CAAGGTGAAG       180
     ATCGAGGCCG CCGTGGCCGA CGATCTGGCC GAGCGCGTCA TCGAGGCCAT CGAGGGCGCC       240
     GCGCGCACCG GCAAGATCGG CGACGGCAAG ATCTTCGTGG CCGACCTGGA GCAGGTCGTG       300
     CGCATCCGCA CCGGCGAGAC CGGCGGGCAG GCCCTTTGA                              339
//

If you have problems or comments...

PBIL Back to PBIL home page