(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE264

ALDEN1_2.PE264       Location/Qualifiers
FT   CDS_pept        301369..302247
FT                   /locus_tag="Alide_0270"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rme:Rmet_5424 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319761002"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102293"
FT                   /translation="MKIPPLNPLKVFEVVARTGNLTLAASELNVSQSAVSRQVAVLEEY
FT                   LGVQLFTRERVGVRLTEVGEGYARRIGPAFGEIAAATEAITRKYSNNVIRLRTYTTLTA
FT                   RWLIPRLPHFKARHPEVEVSILNSTAPLDFGAEQCDLAIVLGDGHWPGAEATLLLEDIV
FT                   EPVCAPGFIAEGAPPEALRGKRLLVSKYRKDDWPRWLAHAGLPELFETAETMVFSSSIL
FT                   TWQAAVDGLGIAIGQQHMLEADFQAGRLVRPLARPLRTGKGHYLVTPALQRYSGKIAAF
FT                   KDWLMVEAMKK"
FT                   /protein_id="YP_004124939.1"
     ATGAAAATCC CCCCGCTCAA CCCCCTCAAG GTCTTCGAGG TCGTCGCGCG CACCGGCAAC        60
     CTCACGCTCG CGGCCAGCGA GCTCAACGTG AGCCAGTCGG CCGTGAGCCG CCAGGTGGCG       120
     GTGCTGGAGG AATACCTGGG CGTGCAGCTC TTCACGCGCG AGCGCGTGGG CGTGCGCCTG       180
     ACCGAGGTGG GCGAGGGCTA CGCGCGCCGC ATCGGCCCCG CGTTCGGCGA GATCGCGGCC       240
     GCCACCGAGG CCATCACGCG CAAGTATTCG AACAACGTCA TCCGCCTGCG CACCTACACC       300
     ACGCTCACCG CGCGTTGGCT CATCCCGCGC CTGCCGCACT TCAAGGCGCG GCACCCGGAG       360
     GTGGAGGTGT CCATCCTCAA CAGCACCGCG CCGCTCGATT TCGGTGCCGA GCAGTGCGAC       420
     CTGGCCATCG TGCTCGGCGA CGGCCACTGG CCCGGCGCCG AGGCCACGCT GCTGCTGGAG       480
     GACATCGTGG AGCCCGTCTG CGCGCCCGGC TTCATCGCCG AAGGTGCGCC GCCCGAGGCG       540
     CTGCGCGGCA AGCGCCTGCT GGTCTCCAAG TACCGCAAGG ACGACTGGCC GCGCTGGCTC       600
     GCGCACGCGG GGCTGCCCGA GCTGTTCGAG ACGGCCGAGA CCATGGTCTT CAGCAGCTCC       660
     ATCCTCACCT GGCAGGCGGC CGTGGATGGC CTGGGCATCG CCATCGGCCA GCAGCACATG       720
     CTGGAGGCGG ACTTCCAGGC AGGCCGCCTC GTGCGCCCGT TGGCCAGGCC GCTGCGCACG       780
     GGCAAGGGCC ACTACCTCGT CACGCCGGCG CTGCAGCGCT ACTCGGGCAA GATCGCGGCG       840
     TTCAAGGACT GGCTGATGGT TGAGGCTATG AAAAAGTGA                              879
//

If you have problems or comments...

PBIL Back to PBIL home page