(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE265

ALDEN1_2.PE265       Location/Qualifiers
FT   CDS_pept        complement(302321..303196)
FT                   /locus_tag="Alide_0271"
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.1.1.60"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.60"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_4431 6-phosphogluconate
FT                   dehydrogenase, NAD-binding; PFAM: 6-phosphogluconate
FT                   dehydrogenase NAD-binding"
FT                   /db_xref="GI:319761003"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="GeneID:10102294"
FT                   /translation="MSGPVLGFIGVGVMGEGMCRNLLAKSGLPVHVADVQAENVARLAA
FT                   QGAVASSVRALRETAHTVFLSLPSIDQVEEVCLGADPLVAPGGSVKTVVDMSTSDVPRT
FT                   RALAGRLAALGVRFLDAPVARSREAANNGTLLITVGGPADLFETVAPWLRCMGSDVVHC
FT                   GGVGAGQVVKIMNNMVLLSTVNSLAEAMAIAEAAGVDKALLAGVLRLGSADSFALKLTG
FT                   ERLATDVFPEKLFPTAYALKDLKLALGLAQASGIQPAVAQATAALLDAACARGYAMNYY
FT                   PVIYRLVEKQ"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /protein_id="YP_004124940.1"
     atgagcggtc cggtcctggg tttcatcggc gtgggcgtga tgggcgaagg catgtgccgc        60
     aacctgctcg ccaagagcgg cctgcctgtg cacgtggccg acgtgcaggc cgagaacgtg       120
     gcgcgcctcg ccgcgcaggg cgcggtggcc tccagcgtgc gcgcgctgcg cgagacggcg       180
     cacacggtgt tcctctcgct gccctcgatc gaccaggtgg aggaggtgtg cctgggcgcc       240
     gacccgctcg tcgcgcccgg cggcagcgtg aagaccgtgg tggacatgag caccagcgac       300
     gtgccgcgca cccgcgcgct ggccgggcgg ctggccgcgc tcggcgtgcg cttcctggac       360
     gcgcccgtgg cccgcagccg cgaggccgcg aacaacggca cgctgctcat caccgtgggc       420
     ggcccggccg atctgttcga gaccgtggcg ccgtggctgc gctgcatggg ctccgacgtg       480
     gtccactgcg gcggcgtggg cgcggggcag gtggtcaaga tcatgaacaa catggtgctg       540
     ctctccaccg tgaattcgct ggccgaggcg atggcgatcg ccgaggccgc gggcgtggac       600
     aaggcgctgc tcgccggcgt gctgcgtttg ggatcggccg attcgttcgc gctcaagctc       660
     acgggcgagc ggctggcgac ggacgtgttc cccgagaagc tcttccccac cgcctacgcc       720
     ctcaaggacc tgaagctggc gctgggcctg gcgcaagcct cgggcatcca gcccgccgtg       780
     gcgcaggcca cggccgcgct gctcgacgcg gcctgcgcgc gcggctatgc gatgaactac       840
     tatccggtga tctaccggct tgtcgaaaaa caatag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page