(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE266

ALDEN1_2.PE266       Location/Qualifiers
FT   CDS_pept        complement(303193..304623)
FT                   /locus_tag="Alide_0272"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /codon_start="1"
FT                   /product="aldehyde dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: amd:AMED_3840
FT                   succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /db_xref="GI:319761004"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="GeneID:10102295"
FT                   /translation="MQYSQFIAGGFRQGTSAERFTVIDPSTGQPLGDYAYATPEDVQAA
FT                   IDAAAKALRSWSRTPAYERATLLRRVAALMRERGSAIAAQIARELGKPIGEAQKEVVTA
FT                   AEMFEWAAEEARRIYGRTIPPRGAGITQTMALEPIGVVAAFAGWNAPAITPSRKISGAL
FT                   AAGCTIVIKPSEETAGVALHIAKAVQDAGVPDGVMNMVFGEPGAIADQLCASPQVHMVT
FT                   FTGATSVGKQIGAKAALTMKRATLELGGHAPVIVCDDTDADRVARAAVATKYRNAGQVC
FT                   TSPTRFLVQAGVFDAFLERFVQDAQALKVGDPFDAATQMGPLKNQRRLQSIERIVQDAR
FT                   ERGLTIATGGERTGTEGFFYRPTVIVRPSLDCDAANIEPFGPVALISPFGDLDEAIAEA
FT                   NRLSFGLAAYAFTNHVRRAHRLAGEIDSGVVCINEWQASLPETPFGGHKDSGLGSEGGV
FT                   EGLMEFLRVKCVRQGVQA"
FT                   /protein_id="YP_004124941.1"
     atgcagtact cccaattcat cgcgggcgga ttccgccagg gcacgtccgc cgagcgcttc        60
     accgtcatcg acccgagcac gggccagccg ctgggcgact acgcctatgc cacgcccgag       120
     gacgtgcagg ccgccatcga cgcggccgcc aaggcgctgc gttcgtggag ccgcacgccg       180
     gcctacgagc gcgccaccct gctgcgccgc gtggccgcgc tgatgcgcga gcgcggcagc       240
     gccatcgccg cccagatcgc gcgcgagctg ggcaagccca tcggcgaggc gcagaaggaa       300
     gtggtgaccg ccgccgagat gttcgaatgg gccgccgagg aggcgcgccg catctacggc       360
     cgcacgattc ccccgcgcgg cgccggcatc acgcagacca tggcgctgga gcccatcggc       420
     gtggtggccg cgttcgcggg ctggaacgcg ccggcgatca cgccctcgcg caagatcagc       480
     ggggctctgg ccgcgggctg caccatcgtc atcaagcctt cggaagaaac cgccggcgtg       540
     gcgctgcaca tcgcaaaggc cgtgcaggac gcgggtgtgc ccgacggcgt gatgaacatg       600
     gtgttcggag agcccggcgc catcgccgac cagctctgcg cctcgccgca ggtgcacatg       660
     gtcaccttca cgggcgccac ctcggtcggc aagcagatcg gcgccaaggc cgcgctgacc       720
     atgaagcgcg ccacgctgga gctgggcggc catgcgccgg tgatcgtctg cgacgacacg       780
     gatgccgacc gcgtggcgcg cgccgccgtg gccaccaagt accgcaacgc gggccaggtc       840
     tgcacctcgc ccacgcgctt cctggtgcag gcgggcgtgt tcgacgcgtt tctcgaacgc       900
     ttcgtgcagg acgcgcaggc gctcaaggtg ggagacccgt tcgatgcggc cacgcagatg       960
     gggccgctga agaaccagcg ccgcctgcag tccatagagc ggatcgtgca ggacgcgcgc      1020
     gaacgaggcc tcaccatcgc cacgggcggc gaacgcaccg gcaccgaggg cttcttctac      1080
     cggcccacgg tgatcgtgcg gccctcgctg gactgcgacg cggccaacat cgagcccttc      1140
     ggccccgtgg cgctcatcag cccgttcggc gatctggacg aggccatcgc cgaggccaac      1200
     cgcctgtcct tcggcctggc ggcctatgcg ttcaccaacc acgtgcggcg cgcccaccgc      1260
     ctcgcgggcg agatcgacag cggcgtggtc tgcatcaacg aatggcaggc ctcgctgccc      1320
     gagacaccct tcggcggcca caaggacagc ggcctgggat cggagggcgg cgtcgagggc      1380
     ctgatggagt tcctgcgcgt gaagtgcgtg cgccaggggg tgcaggcatg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page