(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE268

ALDEN1_2.PE268       Location/Qualifiers
FT   CDS_pept        complement(305633..306412)
FT                   /locus_tag="Alide_0274"
FT                   /gene_family="HOG000144809" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_3256"
FT                   /codon_start="1"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mrd:Mrad2831_3256 beta-lactamase
FT                   domain-containing protein"
FT                   /db_xref="GI:319761006"
FT                   /db_xref="GeneID:10102297"
FT                   /translation="MSEYQILAVKYATVDRARGSNFLHSAPGDPDAPMALDFFVWLIDG
FT                   PGGAVLVDTGFSPASAIARGRRYLVSPPESLRRLGHAPESIRDVVVTHLHYDHAGNVGE
FT                   FPAATAWVQDREMRYATGDCMCDPKQNHFFSTDDVAVLIRRLYQGSVRLVDGFHELRDG
FT                   IELHRVGGHTDGLQVARVRTARGWVVLASDAAHYYENLALQNPFPAIFSLPDMLAGYAR
FT                   IRALADGEDLIVPGHDPAVCTRFESAGVPGVHAYRIA"
FT                   /protein_id="YP_004124943.1"
     gtgagcgaat accagatcct cgccgtgaag tacgccacgg tggaccgcgc gcggggcagc        60
     aacttcctgc actccgcgcc gggcgacccc gacgcgccga tggcgctgga cttcttcgtc       120
     tggctcatcg acgggccggg cggcgcggtg ctggtggaca cgggcttcag ccccgcgtcg       180
     gccatcgcgc gcgggcggcg ctacctggtc tcaccgcccg aatcgctgcg ccgcctgggc       240
     cacgcgcccg agtccatccg cgacgtggtg gtcacgcacc tgcactacga ccacgcgggc       300
     aacgtgggcg agtttcccgc cgccaccgcg tgggtgcagg accgcgagat gcgctacgcc       360
     acgggcgact gcatgtgcga cccgaagcag aaccatttct tctccaccga cgacgtggcc       420
     gtgctcatca ggcgcctgta ccagggcagc gtgcggctcg tcgacggctt ccatgaattg       480
     cgcgacggca tcgagctgca tcgcgtgggc ggccacaccg acggcctgca ggtggcgcgc       540
     gtgcgcaccg cgcgcggctg ggtggtgctg gcctccgacg cggcgcacta ctacgagaac       600
     ctcgcgctgc agaacccctt ccccgccatc ttcagcctgc cggacatgct ggccggctac       660
     gcgcgcatcc gcgcgctggc ggatggcgaa gacctcatcg ttcccggcca cgaccccgcc       720
     gtctgcacgc gcttcgagag cgcgggcgtg cccggcgtgc acgcataccg catcgcctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page