(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE269

ALDEN1_2.PE269       Location/Qualifiers
FT   CDS_pept        complement(306409..307635)
FT                   /locus_tag="Alide_0275"
FT                   /gene_family="HOG000253828" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Reut_B3887"
FT                   /codon_start="1"
FT                   /product="urea/short-chain amide abc transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B3887 UreA/short-chain amide ABC
FT                   transporter"
FT                   /db_xref="GI:319761007"
FT                   /db_xref="GeneID:10102298"
FT                   /translation="MTFTPTKAALGAALLAASMLAPAQDKGARISDGIVKIGVLTDING
FT                   PFMDNVGKGSIVATEIAIEEFKGKVLGYPIQMVTADHQNKADVASTRVREWFDRDQVDA
FT                   VTELGNSAVALAAMRLAQDKNRISIVTGAGAVRISNEDCTPNNLHWVYDTYSLAKVGTQ
FT                   SVVKGGAKTWYYLTADYAFGHSLENDGRHFIEAAGGKVLGSSRYPFPGNDFASYIIKAQ
FT                   GSKANAVAIATAGLDLQNAIKQGKEFGLASGGQKTVAMLMSIMDVHGVGLKDAGGMLFA
FT                   ESFYWDLDDASRAFSRKFFERTKRMPTALQAGQYSATLNYLKAIQKARSDDVADVMKAI
FT                   KSMPIEDAFAKNGKVRADGKMVHDMYLVRVKTPKESQAAWDYYTVLETVPGAQAFHSAA
FT                   ESKCPLLKP"
FT                   /protein_id="YP_004124944.1"
     atgaccttca cccccaccaa ggccgccctc ggcgccgcgc tgctcgccgc ctcgatgctc        60
     gcgcccgcgc aggacaaggg cgcgcgcatc tcggacggca tcgtcaagat aggagtgctg       120
     accgacatca acggcccgtt catggacaac gtgggcaagg gctccatcgt ggcgaccgag       180
     atcgccatcg aggaattcaa gggcaaggtg ctcggctacc ccatccagat ggtcacggcc       240
     gaccaccaga acaaggccga cgtggcctcc acccgcgtgc gcgaatggtt cgaccgcgac       300
     caggtggacg cggtgacgga actgggcaac agcgccgtgg ccctggccgc gatgaggctc       360
     gcacaggaca agaaccgcat ctccatcgtg accggcgcgg gcgcggtgcg gatctcgaac       420
     gaggactgca cgcccaacaa cctgcactgg gtctacgaca cctactcgct cgccaaggtg       480
     ggcacgcagt cggtggtcaa gggcggcgcc aagacctggt actacctcac ggcggactac       540
     gccttcggcc attcgctgga gaacgacggc aggcacttta tcgaggccgc gggcggcaag       600
     gtgctgggct cgtcgcgcta cccctttccg ggcaacgact tcgcctccta catcatcaag       660
     gcccagggca gcaaggccaa cgcggtggcc atcgccacgg cggggctgga cctgcagaac       720
     gccatcaagc agggcaagga gttcggcctc gccagcggcg ggcagaagac cgtggccatg       780
     ctcatgagca tcatggacgt gcacggcgtg ggcctgaagg acgccggcgg catgctgttc       840
     gccgagtcgt tctactggga cctggacgac gcctcgcgcg ccttctcgcg caagttcttc       900
     gagcgcacca agcgcatgcc caccgcgctg caggccgggc agtactcggc cacgctgaac       960
     tacctcaagg ccatacagaa ggccaggtcc gacgacgtgg ccgacgtgat gaaggccatc      1020
     aagagcatgc ccatcgagga tgcgttcgcc aagaacggca aggtgcgcgc cgacggcaag      1080
     atggtccacg acatgtacct cgtgcgcgtg aagacgccca aggaatcgca ggccgcatgg      1140
     gactactaca cggtgctgga gacggtgccg ggcgcgcagg cgttccactc ggccgccgag      1200
     agcaagtgcc cgctgctcaa gccgtga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page