(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE27

ALDEN1_2.PE27        Location/Qualifiers
FT   CDS_pept        complement(35513..36313)
FT                   /locus_tag="Alide_0027"
FT                   /gene_family="HOG000027943" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rme:Rmet_0841 enoyl-CoA hydratase"
FT                   /db_xref="GI:319760765"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:10102050"
FT                   /translation="MAFDTLEIENHGAVRRILLAREAQRNAQSQQMLDELMTALDDARH
FT                   DDGVHAVVIGGKGAHFSAGHDLKQAQAERSSFTVEERWAYEELRYFDYSLRIWDFPKPT
FT                   IAQVQGACVAGGFMIANMCDLVVAGESAYFSDPVGHTLGAAATEVLIHPWVMGARKAKE
FT                   LLFTGGRLSASEAHAIGMVNRVVSDAGLGESTLALAQQIAKAPPFGLRLIKRSINRTLD
FT                   AQGLRTALAAHFDTHQLSHLSEGFLTARDRGLANAIQKNREASA"
FT                   /protein_id="YP_004124702.1"
     atggcgtttg acaccctcga aatagaaaac cacggcgcgg tgcgccgcat cctgctggcg        60
     cgcgaggccc agcgcaatgc ccaaagccag cagatgctcg acgagctgat gaccgctctg       120
     gacgacgccc ggcatgacga cggcgtacat gccgtagtga tcggcggcaa gggcgcgcat       180
     ttctcggccg ggcacgacct caagcaggcc caggccgaac gctccagctt tacggtggag       240
     gagcgctggg cctacgagga gctgcgctac ttcgactact cgctgcgcat atgggacttt       300
     cccaagccca ccatcgccca ggtgcagggc gcctgcgtgg ccggcggttt catgatcgcc       360
     aacatgtgcg acctggtggt ggccggcgag tcggcgtatt tttccgaccc cgtgggccac       420
     acgctgggcg cggcggccac cgaggtactg atccacccct gggtgatggg cgcgcgcaag       480
     gccaaggagc tgctgttcac gggcggcagg ctcagtgcca gcgaggcgca cgccatcggc       540
     atggtcaacc gcgtggtgag cgatgccggg ctgggcgagt ccacgctggc cctcgcgcag       600
     cagatcgcca aggcgccgcc tttcggcctg cggctgatca agcgatcgat caaccgtacg       660
     ctggacgccc agggcctgcg cacggcactg gccgcgcatt tcgacacgca ccagctgtcg       720
     cacctgagcg agggttttct gacggcgcgc gaccggggcc tggccaacgc gatccagaag       780
     aaccgggaag catccgcctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page