(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE270

ALDEN1_2.PE270       Location/Qualifiers
FT   CDS_pept        complement(307797..308687)
FT                   /locus_tag="Alide_0276"
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.1.1.31"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.31"
FT                   /transl_table="11"
FT                   /note="KEGG: esa:ESA_04058 hypothetical protein; PFAM:
FT                   6-phosphogluconate dehydrogenase NAD-binding"
FT                   /db_xref="GI:319761008"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="GeneID:10102299"
FT                   /translation="MKAGFIGLGRMGFALASHLLRNGVQLAVHDIQSAPVDKLVALGAS
FT                   RAASVQALAAGADVVFTMLPGPKQSREVILGEGGVLAGLRRGGCLVELSTIDTDTVDAL
FT                   AAAAEKQGVRFADAPVGRLAAHADRGESLFMLGAHDADRVALEPLLLKMGTTVLHCGAP
FT                   GSGTRMKLINNLMVLCYCQLNSEVLVLAGALGLDARKTFDVLTGTTASNGQLKEKWPVK
FT                   VLAGDLTPGFDIALGFKDLTLACQAAQSAGVSLPMGNLARSLFQLARHAGKDGQDTSCM
FT                   TDFWAESNGQPPVRL"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /protein_id="YP_004124945.1"
     atgaaagccg gattcatcgg cctgggccgc atgggcttcg ccctggcctc ccacctgctg        60
     cgcaacggcg tgcagctcgc ggtgcacgac atccagagcg cgcccgtgga caagctcgtg       120
     gccctgggcg catcgcgcgc ggccagcgtg caggcgctgg ccgccggcgc ggacgtggtg       180
     ttcaccatgc tgcccggccc gaagcagtcg cgcgaggtga tcctgggcga gggcggcgtg       240
     ctggccgggc tgcgcagggg cggctgcctc gtcgagctca gcaccatcga caccgacacg       300
     gtggacgcgc tggccgctgc cgccgagaag cagggcgtgc gcttcgccga cgcgcccgtg       360
     gggcgcctgg cagcgcacgc cgaccggggc gagtcgctgt tcatgctggg cgcccacgat       420
     gccgaccgcg tcgcgctgga gccgctgctg ctcaagatgg gcaccacggt gctgcactgc       480
     ggcgcgccgg gcagcggcac gcgcatgaag ctcatcaaca acctcatggt gctgtgctac       540
     tgccagctca actccgaggt gctggtgctc gccggcgcgc tggggctgga cgcgcgcaag       600
     accttcgatg tgctcacggg caccacggca tccaacgggc agctcaagga gaagtggccc       660
     gtgaaggtgc tcgcgggcga cctcacgccg gggttcgaca tcgcgctggg cttcaaggac       720
     ctgacgctcg cctgccaggc cgcgcagtcg gcgggcgtgt cgctgcccat gggcaacctc       780
     gcgcgcagcc tgttccagct tgcgcggcac gcgggcaagg acgggcagga cacctcgtgc       840
     atgaccgatt tctgggccga gtccaacgga cagcccccag tccggctgtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page