(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE271

ALDEN1_2.PE271       Location/Qualifiers
FT   CDS_pept        complement(308684..309544)
FT                   /locus_tag="Alide_0277"
FT                   /gene_family="HOG000076805" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   msm:MSMEG_2534 carboxylesterase protein"
FT                   /db_xref="GI:319761009"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="GeneID:10102300"
FT                   /translation="MRVEKEAATGGYVNFDIAGRMCRVYYETAGSGQPLLCLHTAGSDT
FT                   RQYRALLNSPELTANHQVICFDMPWHGKSSPPEGWHTEEYRLTSALYVQTILAFMDAMQ
FT                   VERPIAMGCSIGGRVVLHLALQCPERFKALIGLQSGAHVNPYYDLDWLHRPDVHGGEVC
FT                   AGIVSGLVGPGAPERDRWETLWHYMQGGPGVFKGDLHFYTGEGDLRGRVQRIDTARCPL
FT                   YLLTGEYDYSCTPEDSEDLARLIPGAQLQIMPGLGHFPMSEAPQEFLRHLLPVLQRIHT
FT                   NEGNT"
FT                   /protein_id="YP_004124946.1"
     atgcgcgttg aaaaagaagc cgcgaccggc ggctacgtga acttcgatat cgcgggccgc        60
     atgtgccgcg tgtattacga aaccgccggc agcggccagc ccctgctgtg cctgcacacg       120
     gcgggcagcg acacgcgcca gtaccgcgcg ctgctcaact cgcccgagct gaccgcgaac       180
     caccaggtga tctgcttcga catgccgtgg cacggtaagt cgtccccgcc cgagggctgg       240
     cacaccgagg aataccgcct gaccagcgcg ctctacgtgc agaccatcct ggccttcatg       300
     gacgcgatgc aggtcgagcg ccccatcgcc atgggctgct ccatcggcgg gcgcgtggtg       360
     ctgcacctgg cgctgcaatg ccccgagcgc ttcaaggcgc tgatcggcct gcagtcgggc       420
     gcgcacgtca acccctacta cgacttggac tggctgcacc gccccgacgt gcacggcggc       480
     gaggtctgcg cgggcatcgt ctccggcctc gtcggccccg gtgcgcccga gcgcgaccgc       540
     tgggagacgc tgtggcacta catgcaaggc ggccccggcg tgttcaaggg cgacctgcac       600
     ttctacacgg gcgagggcga cctgcgcggg cgcgtgcagc gcatagacac cgcgcgctgc       660
     ccgctctacc tgctcacggg cgaatacgac tattcgtgca cgccggagga cagcgaagac       720
     ctcgcgcgcc tgatccccgg cgcgcagctc cagatcatgc cgggcctggg ccacttcccg       780
     atgagcgagg cgccgcagga gttcctgcgg cacctgctgc ccgtgctgca acgcattcac       840
     accaacgaag gaaatacatg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page