(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE272

ALDEN1_2.PE272       Location/Qualifiers
FT   CDS_pept        complement(309534..309884)
FT                   /locus_tag="Alide_0278"
FT                   /gene_family="HOG000166471" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tcur_0017"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tcu:Tcur_0017 hypothetical protein"
FT                   /db_xref="GI:319761010"
FT                   /db_xref="GeneID:10102301"
FT                   /translation="MHTTNDDWLAHQGRWVNVTFLLRKGDAEYLVTLRDGRVQRIAPGP
FT                   HVMPCWTFALVASDDAWERFWAAEPQPRFHDLMAMVRFKALRIEGDMTVFMRNLLYFKA
FT                   LVKQLGGHIHAR"
FT                   /protein_id="YP_004124947.1"
     atgcacacca ccaacgacga ctggctggcc caccagggcc gctgggtcaa cgtgaccttc        60
     ctgctcagga aaggcgacgc cgaatacctc gtcaccctgc gcgacggacg cgtgcagcgc       120
     atcgcgcccg gcccgcacgt gatgccgtgc tggaccttcg cgctcgtcgc gagcgacgac       180
     gcgtgggagc gcttctgggc cgccgagccg cagccgcgct tccacgacct gatggccatg       240
     gtgcgcttca aggcgctgcg catcgagggc gacatgacgg tgttcatgcg caacctgctg       300
     tatttcaagg cactcgtgaa gcagctcgga ggacacatcc atgcgcgttg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page