(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE273

ALDEN1_2.PE273       Location/Qualifiers
FT   CDS_pept        complement(309967..311034)
FT                   /locus_tag="Alide_0279"
FT                   /gene_family="HOG000247836" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03082"
FT                   /codon_start="1"
FT                   /product="membrane protein abrb duplication"
FT                   /transl_table="11"
FT                   /note="KEGG: vap:Vapar_4786 membrane protein AbrB
FT                   duplication; TIGRFAM: membrane protein AbrB duplication;
FT                   PFAM: ammonia monooxygenase"
FT                   /db_xref="GI:319761011"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="GeneID:10102302"
FT                   /translation="MRSTLSKLLTLLLAWAAAEGCRRLRMPVPWMLGPLLATALATMAG
FT                   QPTRSSLRLRNCGQWVMGASLGLYFTPPVVAQLIGLWWAVLAAVAWALALGAAYGRWLY
FT                   RSCAGRLRGVSDAALRPSAYFAGAIGAASEMTLLAEREGARTDLVAASHSLRMLIVVLV
FT                   MPFGMLLAKAWWNLETVDLVPPASAPFAAAGLAWLALFTGAGGLALQLGRLPNPWFLGP
FT                   LLVAIGLSATGTAPSGVPTPLSNAAQLVIGVSLGVRFSPLFLHTAPRWLAQVALGTLGL
FT                   LAACAAFGLLLAWATGLHAATAILGTAPGGMTEMSITAKVLQLGVPVVTALQVTRLVAV
FT                   LVLVRPAYRLWARQP"
FT                   /protein_id="YP_004124948.1"
     gtgcgtagca ccctctccaa gctcctcaca ctgctgctgg cctgggcggc ggccgagggc        60
     tgccgccgcc tgcgcatgcc cgtcccatgg atgctgggcc cgctgctcgc cacggcgctg       120
     gccacgatgg ccggccagcc cacgcgcagc agcctgcggc tgcgcaactg cgggcaatgg       180
     gtgatgggcg cgtcgctggg cctgtacttc acgccgcccg tcgtggcgca gcttatcggc       240
     ctgtggtggg ccgtgctcgc ggccgtggcc tgggcgctgg cgctgggcgc ggcctacggg       300
     cgctggctgt accgctcctg cgcggggcgg ctgcgcggcg tgagcgacgc ggcgctgcgc       360
     ccctcggcct acttcgctgg cgccatcggc gcggcgtcgg agatgacgct gctggccgag       420
     cgcgagggcg cgcgcaccga cctcgtggcc gcatcgcaca gcctgcgcat gctgatcgtg       480
     gtgctggtca tgcccttcgg catgctgctg gccaaggcct ggtggaacct ggagacggtg       540
     gacctcgtcc cgccggccag cgcgcccttc gcggcggcgg gcctcgcgtg gctggcgctg       600
     ttcacgggcg ccgggggcct ggccctgcag ctcgggcgcc tgcccaaccc gtggttcctc       660
     ggcccgctgc tggtggccat agggctgtcg gccacgggca cggcgccctc gggcgtgccc       720
     acgccgctgt cgaacgcggc gcaactcgtc atcggcgtga gcctgggcgt gcgcttcagc       780
     ccgctgttcc tgcacactgc gccgcgctgg ctcgcgcagg tggcgctggg cacgctgggc       840
     ctgctggcgg cctgcgccgc gttcggcctg ctgctggcct gggccacggg cctgcacgcg       900
     gccaccgcca tcctgggcac ggcgcccggg ggcatgacgg agatgtccat caccgccaag       960
     gtgctgcagc tgggcgtgcc cgtggtcact gcgctgcagg tgacgcggct ggtggcggtg      1020
     ctggtgctcg tgcggccggc gtaccggctc tgggcgcggc agccatga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page