(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE275

ALDEN1_2.PE275       Location/Qualifiers
FT   CDS_pept        312538..313692
FT                   /locus_tag="Alide_0281"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: rme:Rmet_5425 butyryl-CoA dehydrogenase"
FT                   /db_xref="GI:319761013"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102304"
FT                   /translation="MDFTLSEEHQAFADSVARFAQDKLKDGALARAHSPHYPWETAALL
FT                   AEQGLLGIAFPEEDHGQGGTLMHAVLAIEQVALVCPKSADIVQAGNFGPIRTFVEYATP
FT                   EQKQRFLPDLLAGRKLISLGMSEPDAGSAVTELKTSARQEGDGYVINGSKVFSTHSPEA
FT                   DLFLVYVRFGPGVGGIGSVLVERGTPGFQVGEPSSFMNGERWSQLYFDECRIPAANVLL
FT                   GPGGFKKQISGFNVERLGNSARALALGRHAFNTAREHALTRKQFGRELCEFQGIQWKFA
FT                   EMAMKLEQAQLMLYRAAMEGEHGLPSAQSTAMAKLACNLAGWEVSNEALQVMGGTGFSQ
FT                   ECLVEYCVRRTRGWMIAGGSIEILKNRIAEGVFGRTFPQRPGKG"
FT                   /protein_id="YP_004124950.1"
     ATGGATTTCA CACTCAGCGA AGAACACCAG GCATTCGCCG ATTCGGTGGC GCGCTTTGCC        60
     CAGGACAAGC TCAAGGACGG CGCGCTCGCG CGCGCGCATT CGCCCCACTA CCCCTGGGAG       120
     ACGGCCGCCC TGCTGGCCGA GCAGGGCCTG CTGGGCATCG CCTTCCCCGA GGAAGACCAC       180
     GGCCAGGGCG GCACGTTGAT GCACGCGGTG CTCGCCATCG AGCAGGTCGC GCTGGTCTGC       240
     CCCAAGAGCG CCGACATCGT GCAGGCGGGC AACTTCGGCC CCATCCGCAC CTTCGTCGAA       300
     TACGCTACGC CTGAACAGAA GCAGCGCTTC CTGCCCGACC TGCTCGCGGG CCGCAAGCTG       360
     ATCTCGCTGG GCATGAGCGA GCCCGACGCG GGCTCGGCCG TCACAGAGCT CAAGACCAGC       420
     GCGCGCCAGG AGGGCGACGG GTACGTCATC AACGGCAGCA AGGTGTTCTC CACCCACAGC       480
     CCCGAGGCCG ACCTGTTCCT CGTCTACGTG CGCTTCGGCC CCGGCGTGGG CGGCATCGGC       540
     TCGGTGCTCG TGGAGCGCGG CACGCCGGGC TTCCAGGTGG GCGAGCCCTC GTCGTTCATG       600
     AACGGCGAGC GCTGGTCGCA GCTGTATTTC GACGAATGCC GCATCCCGGC GGCCAACGTG       660
     CTGCTGGGGC CGGGCGGGTT CAAGAAGCAG ATCTCGGGCT TCAACGTGGA GCGCCTGGGC       720
     AATTCCGCGC GCGCGCTGGC CCTCGGCCGC CATGCGTTCA ACACGGCGCG AGAGCATGCG       780
     CTCACGCGCA AGCAGTTCGG GCGCGAGCTG TGCGAGTTCC AGGGCATCCA GTGGAAGTTC       840
     GCCGAGATGG CGATGAAGCT GGAGCAGGCC CAGCTCATGC TCTACCGCGC CGCGATGGAG       900
     GGCGAGCACG GCCTGCCCAG CGCGCAGAGC ACGGCCATGG CCAAGCTGGC CTGCAACCTC       960
     GCGGGCTGGG AGGTTTCCAA CGAGGCCCTG CAGGTCATGG GCGGCACGGG CTTCAGCCAG      1020
     GAATGCCTGG TGGAGTACTG CGTGCGCCGC ACGCGCGGCT GGATGATCGC GGGCGGCTCC      1080
     ATCGAGATAT TGAAGAACCG CATCGCCGAG GGCGTGTTCG GCCGCACTTT TCCGCAACGG      1140
     CCCGGCAAGG GCTGA                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page