(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE276

ALDEN1_2.PE276       Location/Qualifiers
FT   CDS_pept        313716..314690
FT                   /locus_tag="Alide_0282"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Veis_3320"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_3320 hypothetical protein"
FT                   /db_xref="GI:319761014"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102305"
FT                   /translation="MKRSLLSLAALAACAWSIAVPAAADAAYPAKPVRIIVGYSAGGPT
FT                   DAVARLVAAHLQTKLGQPFVVDNRAGAGSNIASEAVAAAAPDGYTLLVAAAPLTMNSHV
FT                   YKNLKFDAVKSFVPISKLSSAPGVLAVRTDWGVGSVKEFVAAAKKEPGKFTYGTTGLGG
FT                   SQHMATELFQRLAGVKLTHIPYKGASNVMTDLIAGHVDLAFMTATGAMPHLQAGKVKPL
FT                   AVAGPQRLSGLPNVPTFAEAGYPAMISDSWNGLLAPAGTPEAIVKKLHAAAAEALQMPE
FT                   TRTKLESQGAIVIGNSPEEFRADIQREVAHWAEQFKAIKIEMQ"
FT                   /protein_id="YP_004124951.1"
     ATGAAACGCA GCCTTCTTTC CCTGGCCGCG CTCGCGGCCT GCGCATGGAG CATCGCCGTG        60
     CCCGCCGCGG CCGATGCCGC CTATCCCGCC AAGCCCGTGC GCATCATCGT AGGCTATTCC       120
     GCGGGCGGCC CCACGGACGC GGTCGCGCGC CTGGTCGCTG CGCACCTGCA GACGAAGCTG       180
     GGCCAGCCCT TCGTGGTGGA CAACCGCGCG GGCGCGGGCT CCAACATCGC GTCCGAGGCC       240
     GTGGCCGCCG CCGCGCCCGA CGGCTACACG CTGCTCGTGG CCGCCGCGCC GCTCACGATG       300
     AACAGCCATG TCTACAAGAA CCTGAAGTTC GATGCCGTCA AGAGCTTCGT CCCTATCTCC       360
     AAGCTCTCGT CCGCGCCTGG TGTGCTCGCC GTGCGGACCG ACTGGGGCGT GGGCAGCGTC       420
     AAGGAGTTCG TGGCCGCCGC GAAGAAGGAG CCCGGCAAGT TCACCTACGG CACCACGGGC       480
     CTGGGCGGCT CGCAGCACAT GGCGACGGAG CTGTTCCAGC GCCTGGCAGG CGTCAAGCTC       540
     ACGCACATCC CCTACAAGGG CGCGAGCAAC GTGATGACCG ACCTGATCGC GGGCCACGTG       600
     GACCTGGCCT TCATGACTGC CACCGGCGCC ATGCCGCACC TGCAGGCGGG CAAGGTGAAG       660
     CCCCTGGCCG TCGCGGGGCC GCAGCGCCTC TCGGGCCTGC CGAACGTGCC CACGTTCGCC       720
     GAGGCGGGCT ACCCTGCGAT GATCTCTGAC TCGTGGAACG GCCTGCTGGC ACCCGCGGGC       780
     ACGCCCGAGG CCATCGTGAA GAAGCTCCAC GCCGCCGCCG CCGAGGCGCT GCAGATGCCC       840
     GAGACCCGCA CCAAGCTTGA ATCGCAGGGC GCCATCGTGA TCGGCAACAG CCCCGAGGAA       900
     TTCCGCGCCG ACATCCAGCG CGAGGTGGCG CACTGGGCCG AGCAGTTCAA GGCCATCAAG       960
     ATCGAAATGC AATGA                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page