(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE277

ALDEN1_2.PE277       Location/Qualifiers
FT   CDS_pept        314687..316762
FT                   /locus_tag="Alide_0283"
FT                   /gene_family="HOG000220089" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /codon_start="1"
FT                   /product="CoA-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   dac:Daci_1885 CoA-binding domain-containing protein"
FT                   /db_xref="GI:319761015"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="GeneID:10102306"
FT                   /translation="MTPDNDKRLAQALLHPASVALYGASDDVDKMGGRPVQFLKRTGFA
FT                   GRIYPINPRRDEIQGLKAWPSLQSLPEVPDQVFVLTPTETVIPAVRECAALGVKVVTIL
FT                   ASGFSESGAEGAAREGELRRIAKETGIRILGPSSLGVVNPRTGLVLTANAAFAEPDLPP
FT                   GKVFVASHSGSMIGALVSRGKARGVGFAGLVSVGSEVDLNVGEICAATLDDPAIEGYLL
FT                   FLESLRHGPELRAFARAAHARGKPVIAYKLGRSAAAAEMATTHTGAIAGEDDIADAFLK
FT                   DMGVARVGVLEALLETFPLARRIPLESAPKRVGVVTTTGGGAAMAVEQLGIRGVVVEPP
FT                   SADALKRLEQAGLPCTPGRVLDMTLAGTKYETMKATLDILLTAPEFDLVLAVVGSSARF
FT                   QPQLAVKPIVECAGGPKPLAAMLVPDAPEALAALTAAGVPCFRAPEACGDAIAAVLARR
FT                   RPGPEPVLPAPGPARTLSEAEAYGVLHELGVPHAPVALRCFGEAPAPLPFAYPVVAKVC
FT                   SAEIPHKTEVGGVLLNIGSDEELAAALATLRRNLDERAPKAACDEVLVQPMQKGLSEVL
FT                   VGYRVDPDAGPIVMLAAGGIWAEVAKDRSIRLAPVTVETAREMVAEVNALKPLTGLRGK
FT                   ARGDLEALARTVSALSQLALKPELGIAEAEVNPLLVLPEGQGVVAVDALVFQRTPA"
FT                   /protein_id="YP_004124952.1"
     ATGACACCAG ACAACGACAA ACGGCTCGCC CAGGCGCTGC TGCATCCGGC CAGCGTCGCG        60
     CTCTACGGCG CCTCCGACGA CGTGGACAAG ATGGGCGGGC GGCCCGTGCA GTTCCTCAAG       120
     CGCACGGGCT TCGCGGGCCG CATCTATCCC ATCAACCCGC GGCGCGACGA GATCCAGGGC       180
     CTGAAGGCCT GGCCCAGCCT GCAGAGCCTG CCCGAGGTGC CCGACCAGGT GTTCGTGCTC       240
     ACGCCGACCG AGACCGTGAT CCCGGCCGTG CGCGAATGCG CGGCCCTGGG CGTGAAGGTG       300
     GTCACCATCC TCGCGAGCGG CTTCTCCGAA TCCGGCGCCG AAGGCGCGGC GCGCGAGGGC       360
     GAGCTGCGCC GGATCGCCAA GGAGACGGGC ATCCGCATCC TCGGCCCCAG CAGCCTGGGC       420
     GTGGTCAACC CGCGCACGGG GCTGGTGCTT ACGGCCAACG CGGCCTTCGC CGAGCCCGAC       480
     CTGCCGCCCG GCAAGGTGTT CGTCGCATCG CACAGCGGCA GCATGATCGG CGCGCTGGTC       540
     TCGCGCGGCA AGGCGCGCGG CGTGGGCTTC GCGGGGCTGG TGTCGGTGGG CAGCGAGGTG       600
     GACTTGAACG TGGGCGAGAT CTGCGCCGCC ACGCTCGATG ACCCGGCCAT CGAGGGCTAC       660
     CTGCTGTTTC TCGAGAGCCT GCGCCACGGC CCCGAGCTGC GCGCCTTCGC GCGCGCGGCG       720
     CATGCCAGGG GCAAGCCCGT GATCGCCTAC AAGCTCGGCC GCTCGGCGGC GGCGGCCGAG       780
     ATGGCCACCA CGCACACGGG TGCCATCGCG GGCGAGGACG ACATCGCCGA CGCATTCCTG       840
     AAAGACATGG GCGTCGCCCG CGTGGGCGTG CTCGAAGCGC TGCTCGAAAC CTTCCCGCTC       900
     GCGCGGCGCA TTCCGCTGGA GAGTGCGCCC AAGCGCGTCG GCGTGGTCAC CACCACGGGC       960
     GGCGGCGCGG CCATGGCGGT GGAGCAGCTC GGCATCCGCG GCGTGGTCGT GGAGCCGCCT      1020
     TCGGCCGACG CCCTGAAGCG GCTGGAGCAG GCCGGCCTGC CCTGCACGCC GGGCCGCGTG      1080
     CTCGACATGA CGCTTGCGGG CACCAAGTAC GAGACCATGA AGGCCACGCT GGACATCCTG      1140
     CTCACCGCGC CCGAGTTCGA CCTCGTGCTG GCCGTGGTGG GCTCGTCCGC GCGCTTTCAG      1200
     CCGCAGCTGG CCGTCAAACC CATCGTCGAA TGCGCGGGCG GCCCCAAGCC GCTCGCCGCC      1260
     ATGCTGGTGC CCGACGCGCC CGAGGCGCTG GCCGCGCTCA CCGCTGCTGG CGTGCCCTGC      1320
     TTCCGCGCGC CCGAGGCCTG CGGCGACGCC ATCGCCGCCG TGCTCGCGCG CCGCCGGCCG      1380
     GGGCCCGAGC CCGTGCTGCC CGCGCCCGGT CCCGCGCGCA CCTTGAGCGA GGCCGAGGCC      1440
     TACGGCGTGC TCCATGAACT CGGCGTGCCG CATGCGCCCG TGGCCTTGCG CTGCTTCGGC      1500
     GAGGCGCCCG CGCCGCTGCC CTTCGCCTAC CCGGTGGTCG CCAAGGTCTG CTCGGCCGAG      1560
     ATCCCGCACA AGACCGAGGT CGGCGGCGTG CTGCTGAACA TCGGCAGCGA CGAGGAACTG      1620
     GCGGCGGCAC TGGCCACGCT GCGCCGCAAC CTCGACGAGC GCGCCCCGAA GGCCGCGTGC      1680
     GACGAGGTAC TGGTGCAGCC CATGCAAAAG GGCTTGTCCG AGGTGCTCGT GGGCTACCGC      1740
     GTCGATCCCG ACGCCGGCCC CATCGTCATG CTCGCTGCGG GCGGTATCTG GGCCGAGGTC      1800
     GCCAAGGATC GCAGCATCCG CCTCGCCCCG GTGACGGTGG AGACGGCGCG CGAGATGGTC      1860
     GCCGAGGTCA ATGCCTTGAA GCCCCTGACG GGCCTGCGCG GCAAGGCGCG CGGCGACCTG      1920
     GAGGCTCTGG CGCGCACGGT GAGCGCGCTC TCGCAGCTGG CGCTCAAGCC GGAACTGGGC      1980
     ATCGCCGAGG CCGAGGTCAA TCCGCTGCTC GTCCTGCCCG AGGGGCAGGG CGTGGTGGCG      2040
     GTGGACGCGC TGGTGTTCCA GCGGACGCCA GCCTGA                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page