(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE278

ALDEN1_2.PE278       Location/Qualifiers
FT   CDS_pept        316836..317948
FT                   /locus_tag="Alide_0284"
FT                   /gene_family="HOG000230994" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /codon_start="1"
FT                   /product="fad linked oxidase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   dia:Dtpsy_0184 FAD linked oxidase domain protein"
FT                   /db_xref="GI:319761016"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="GeneID:10102307"
FT                   /translation="MEAALRQIIDRVRDSADRRALLRIRGGGTKDFHGPGAPAHAGEPL
FT                   DMRPLAGIVSYEPSELVVTALAGTPLAELEALLAQHGQSLPFEPPRFAPGGTVGGMVAA
FT                   GLSGPARASVGAVRDYVLGVEIINGKGELLRFGGQVMKNVAGYDVSRLMAGSWGQLGII
FT                   TEVSLKVLPVPPAEATLRFDCGQAEALARLHAWGGQPLPLNASCWVQDGGGAGRLYVRL
FT                   RGARAAVQAACRSMGGAPQDAPTVPADWQACRDQRLPWFTARAADHALWRLSVPQTAPV
FT                   LALPAGVAPPLVEWHGGLRWVQAPARHGDELRALARQVGGSASCFVAAGADGTGAAALF
FT                   DANDGALAIVHQRLRQAFDPAGILNPGRLV"
FT                   /protein_id="YP_004124953.1"
     ATGGAAGCAG CCCTTCGCCA GATCATCGAC CGCGTGCGCG ACAGCGCAGA CCGCCGTGCC        60
     CTGCTGCGCA TCCGCGGCGG CGGCACCAAG GACTTCCATG GCCCCGGCGC GCCGGCCCAT       120
     GCGGGCGAGC CGCTGGACAT GCGGCCGCTC GCGGGCATCG TCAGCTACGA GCCCAGCGAG       180
     CTGGTGGTGA CGGCCCTGGC CGGCACGCCG CTGGCGGAGC TGGAGGCGCT GCTTGCCCAG       240
     CATGGCCAGA GCCTGCCGTT CGAGCCGCCG CGCTTCGCCC CCGGCGGTAC CGTGGGCGGC       300
     ATGGTGGCGG CCGGCCTGTC GGGCCCGGCG CGCGCCAGCG TGGGCGCGGT GCGCGACTAC       360
     GTGCTGGGCG TGGAGATCAT CAACGGCAAA GGCGAACTGC TGCGCTTCGG CGGCCAGGTG       420
     ATGAAGAACG TGGCCGGCTA CGACGTCTCG CGCCTCATGG CGGGCAGCTG GGGGCAGCTG       480
     GGCATCATCA CCGAGGTCAG CCTCAAGGTG CTCCCCGTGC CGCCGGCCGA GGCCACGCTG       540
     CGCTTCGACT GCGGCCAGGC CGAGGCGCTT GCGCGCCTGC ACGCCTGGGG CGGCCAGCCG       600
     CTGCCGCTGA ACGCCAGTTG CTGGGTGCAG GATGGCGGTG GCGCGGGCCG GCTCTACGTG       660
     CGCCTGCGCG GCGCGCGCGC CGCCGTGCAG GCGGCGTGCC GCAGCATGGG CGGCGCGCCG       720
     CAGGATGCGC CCACGGTTCC CGCCGACTGG CAGGCCTGCC GCGACCAGCG CCTGCCCTGG       780
     TTCACGGCGC GCGCGGCCGA TCATGCGCTG TGGCGCCTGT CGGTGCCGCA GACGGCGCCG       840
     GTGCTGGCGC TGCCCGCGGG GGTGGCGCCG CCGCTGGTCG AATGGCATGG CGGCCTGCGC       900
     TGGGTGCAGG CGCCGGCGCG GCATGGCGAC GAACTGCGGG CGCTGGCCCG GCAGGTGGGC       960
     GGCAGTGCTT CTTGTTTTGT AGCTGCTGGC GCTGATGGGA CGGGCGCGGC AGCACTTTTC      1020
     GATGCCAATG ACGGGGCGCT GGCCATAGTG CACCAGCGGC TCAGGCAGGC GTTCGACCCG      1080
     GCCGGCATCC TCAACCCCGG CAGGCTCGTC TAG                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page