(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE279

ALDEN1_2.PE279       Location/Qualifiers
FT   CDS_pept        317951..318724
FT                   /locus_tag="Alide_0285"
FT                   /gene_family="HOG000268664" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06912"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   dia:Dtpsy_0185 protein of unknown function DUF1275"
FT                   /db_xref="GI:319761017"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="GeneID:10102308"
FT                   /translation="MRLLRHLTGRYRTPVANRTLGLLLAFNAGGINAGGFLVVGMYTSH
FT                   MTGIVSTVGDNLVLGNMALVLGALGTLWAFMSGAGSTAIMVNWARHQHLRSTFALPLLL
FT                   EAVLMLLFGLMGAITLTWRTPFAVPLTVLLLAYLMGLQNAVITKMSSAEIRTTHMTGIC
FT                   TDIGIELGKALYWNRGGRPAHEQVHVNHKRLRLFASLLSMFMAGGVVGAAGFKYVGFIW
FT                   VVPLATVLLVLSLPPLAADFDRLGLAWRRRSSRGQ"
FT                   /protein_id="YP_004124954.1"
     ATGCGCCTGC TGCGCCACCT GACGGGGCGG TACCGCACCC CGGTCGCCAA CCGCACGCTG        60
     GGCCTGCTGC TGGCCTTCAA CGCGGGCGGC ATCAATGCCG GGGGATTCCT GGTGGTGGGC       120
     ATGTACACCT CGCACATGAC GGGCATCGTC TCCACCGTGG GCGACAACCT GGTGCTGGGC       180
     AACATGGCGC TGGTGCTGGG CGCGCTGGGC ACGCTGTGGG CCTTCATGTC GGGGGCGGGC       240
     AGCACCGCCA TCATGGTCAA CTGGGCGCGC CACCAGCACC TGCGCAGCAC CTTCGCGCTG       300
     CCGCTGCTGC TGGAGGCCGT GCTCATGCTG CTGTTCGGCC TGATGGGCGC CATCACGCTC       360
     ACCTGGCGCA CGCCCTTCGC GGTGCCGCTC ACGGTGCTGC TGCTGGCCTA CCTCATGGGG       420
     CTGCAGAACG CCGTCATCAC CAAGATGTCG TCGGCCGAGA TCCGCACCAC GCACATGACC       480
     GGCATTTGCA CCGACATCGG CATCGAGCTG GGCAAGGCCC TGTACTGGAA CCGCGGCGGC       540
     AGGCCGGCGC ACGAGCAGGT GCACGTCAAC CACAAGCGGC TGCGCCTGTT CGCCAGCCTG       600
     CTGTCCATGT TCATGGCTGG CGGCGTGGTG GGGGCGGCCG GCTTCAAGTA CGTGGGCTTC       660
     ATCTGGGTGG TGCCGCTGGC CACCGTGCTG CTGGTGCTGT CGCTGCCGCC GCTGGCGGCC       720
     GACTTCGACC GCCTGGGGCT GGCGTGGCGC AGGCGCTCTT CCCGCGGCCA GTGA             774
//

If you have problems or comments...

PBIL Back to PBIL home page