(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE28

ALDEN1_2.PE28        Location/Qualifiers
FT   CDS_pept        36408..37172
FT                   /locus_tag="Alide_0028"
FT                   /gene_family="HOG000142058" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: bpt:Bpet3285 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760766"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102051"
FT                   /translation="MDTPQGTAGAQSLRRALQLLRLLAQHQEDGIRLTEVMAASGLERS
FT                   TAHRLLSCLVEEQFAERDPGSKAYRLGLDAMQLGFASMRRVPLVDHCRPLMQRLARMSG
FT                   DTVFLVIRQGDYCLCLHREEGHFPVKVFTTDVGGRRLLGLGAGGLALMAQLSDAEVERI
FT                   FDRHVEEYTQACFTRERLQQAVRRTRAAGYADIVDTLTVGVSGVGATFAASPGTLAAIS
FT                   FGAITPRLPPERKREMARLLMDQLVSNQAGGA"
FT                   /protein_id="YP_004124703.1"
     ATGGATACAC CACAGGGAAC CGCCGGCGCG CAGAGCCTGC GCCGGGCATT GCAGCTGCTG        60
     CGCCTGCTGG CGCAGCACCA GGAGGACGGC ATCCGCCTCA CCGAGGTCAT GGCCGCCTCT       120
     GGCCTGGAGC GCTCCACGGC CCACCGCCTT CTGTCCTGCC TGGTGGAGGA GCAGTTCGCC       180
     GAGCGCGACC CCGGGAGCAA GGCCTACCGC CTGGGCCTGG ACGCGATGCA GCTGGGCTTC       240
     GCCTCGATGC GGCGCGTGCC GCTGGTGGAC CACTGCCGCC CGCTCATGCA GCGGCTGGCG       300
     CGCATGTCGG GCGACACGGT ATTCCTCGTG ATACGCCAGG GCGACTACTG CCTGTGCCTG       360
     CACCGCGAGG AAGGGCATTT CCCGGTCAAG GTGTTCACCA CCGACGTGGG CGGGCGCCGG       420
     CTGCTGGGTT TGGGCGCGGG CGGGCTGGCG CTGATGGCGC AGCTCTCCGA CGCCGAGGTG       480
     GAGCGCATCT TCGACCGCCA CGTGGAGGAA TACACCCAGG CTTGCTTCAC GCGCGAGCGC       540
     CTGCAACAGG CCGTGCGGCG TACGCGCGCC GCCGGCTACG CCGACATCGT GGACACGCTC       600
     ACCGTCGGCG TATCAGGCGT GGGCGCCACG TTCGCGGCGT CGCCCGGCAC GCTGGCTGCC       660
     ATCAGCTTCG GCGCCATCAC GCCCCGCCTG CCACCCGAGC GCAAGCGGGA GATGGCGCGG       720
     CTCCTCATGG ACCAGCTGGT GTCGAACCAG GCCGGCGGCG CCTGA                       765
//

If you have problems or comments...

PBIL Back to PBIL home page