(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE281

ALDEN1_2.PE281       Location/Qualifiers
FT   CDS_pept        320062..320793
FT                   /locus_tag="Alide_0287"
FT                   /gene_family="HOG000228951" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04352"
FT                   /codon_start="1"
FT                   /product="fertility inhibition fino-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Fertility inhibition FinO-like; KEGG:
FT                   dia:Dtpsy_0187 ProQ activator of osmoprotectant transporter
FT                   ProP"
FT                   /db_xref="GI:319761019"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="GeneID:10102310"
FT                   /translation="MNDSVNALQPSAEAAQPVQPAAPVAAVEAAGNDAAPRRTHPLLEQ
FT                   LAGWYPHLFGMQCLPLKRGIFHDLMAAHGEAIDKDALKLALSIHTRSTRYLNAVAQGLR
FT                   RHDLQGQPVEDMAPEHVHHALLEVFRRRKPRDGEDLALKLRRRIAQAFEASGLTREAYD
FT                   ALVRGRDEKANALLDEAFAEVAEQGAKAEALLRAFEASGATPEQFADMYGMDRRVVTQS
FT                   LARARRLRAPAAQAAAPGEAP"
FT                   /protein_id="YP_004124956.1"
     ATGAACGATT CCGTGAACGC ACTCCAGCCC TCCGCCGAAG CCGCGCAACC CGTCCAGCCC        60
     GCCGCGCCCG TCGCTGCCGT GGAGGCCGCG GGCAATGACG CCGCGCCGCG CCGCACGCAC       120
     CCGCTGCTGG AGCAACTGGC CGGCTGGTAC CCGCACCTGT TCGGCATGCA GTGCCTGCCG       180
     CTCAAGCGCG GCATCTTCCA CGACCTGATG GCCGCACATG GCGAAGCCAT CGACAAGGAC       240
     GCGCTCAAGC TCGCGCTGTC CATCCACACG CGCTCCACGC GCTATCTGAA CGCCGTGGCC       300
     CAGGGACTCA GGCGCCACGA CCTGCAGGGC CAGCCCGTGG AGGACATGGC GCCCGAGCAT       360
     GTGCACCACG CGCTGCTGGA GGTGTTCCGC CGCCGCAAGC CGCGCGATGG CGAGGACCTC       420
     GCCCTCAAGC TGCGCCGCCG CATTGCCCAG GCCTTCGAGG CCTCGGGCCT CACGCGCGAG       480
     GCCTACGACG CGCTGGTGCG CGGCCGCGAC GAAAAGGCCA ACGCCCTGCT CGACGAGGCC       540
     TTTGCCGAGG TCGCCGAGCA GGGCGCCAAG GCCGAGGCCC TGCTGCGCGC CTTCGAGGCC       600
     AGCGGCGCCA CGCCCGAGCA GTTCGCCGAC ATGTACGGCA TGGACCGGCG CGTGGTCACG       660
     CAGTCCCTGG CGCGGGCGCG CAGGCTGCGG GCGCCCGCGG CGCAGGCCGC CGCGCCGGGC       720
     GAGGCGCCGT AG                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page