(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE282

ALDEN1_2.PE282       Location/Qualifiers
FT   CDS_pept        complement(320851..321735)
FT                   /locus_tag="Alide_0288"
FT                   /gene_family="HOG000261801" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ajs:Ajs_0174 hypothetical protein"
FT                   /db_xref="GI:319761020"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="GeneID:10102311"
FT                   /translation="MHSPLPALALLFNAFVWGLSWWPFRQMQGAGLHPLWATALMYCAI
FT                   LVAMLALRPGVLAQLRAHPGLWLLALSSGLNNVAFNWAITIGDVVRVILLFYLMPAWAV
FT                   LLAWRILGERPTAQALARLLMAFCGVLLVLWPAEGGVRRLFAALTLADMLALLGGFMFA
FT                   LTNVTVRRLHAVPGQARMFAMFGGCLLLALLVANLGRSVGLVTAFPPPDATWITVAALL
FT                   SLLLMAGNWALQFGAARLAAGTTAVIMLSEVVFASGSSVLLGASRLTAGTLAGGALILL
FT                   AATWSAWRPRARG"
FT                   /protein_id="YP_004124957.1"
     atgcattcac cgcttcccgc gctggccctg ctgttcaacg ctttcgtctg gggcctgtcc        60
     tggtggccgt tccggcagat gcagggcgcg ggcctgcacc cgctgtgggc cacggcgctg       120
     atgtactgcg ccatcctcgt ggcgatgctg gcgctgcgcc ccggcgtgct ggcccagctg       180
     cgcgcgcacc cgggcctatg gctgctggcg ctgagttcgg ggctcaacaa cgtggccttc       240
     aactgggcca tcaccatcgg cgacgtggtg cgcgtgatcc tgctgttcta cttgatgccg       300
     gcctgggcgg tgctgctggc ctggcgcatc ctgggcgagc ggcccacggc gcaggcgctg       360
     gcgcggctgc tgatggcctt ctgcggcgta ctgctggtgc tgtggcccgc cgagggcggc       420
     gtgcggcgcc tgttcgccgc gctgacgctg gccgacatgc tggcgctgct gggcggcttc       480
     atgttcgcgc tcaccaacgt cacggtacgc cgcctgcacg ccgtgccggg gcaggcgcgc       540
     atgttcgcca tgttcggcgg ctgcctgctg ctggcgctgc tggtggccaa cctgggtcgg       600
     tccgtgggcc tggtgaccgc gtttccaccg cccgacgcca cctggatcac ggtggccgcg       660
     ctgctgtcgc tgctgctgat ggcgggcaac tgggccctgc agttcggcgc ggcgcgcctg       720
     gcggcgggca cgacggcggt gatcatgctg tcggaggtgg tgttcgccag cggctcgtcg       780
     gtgctgctgg gcgcgtcccg gctcacggcc ggcacgctgg ccggcggcgc gctgatcctg       840
     ctggccgcca cctggtcggc ctggcggccg cgcgctcgcg gatga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page