(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE285

ALDEN1_2.PE285       Location/Qualifiers
FT   CDS_pept        324523..325542
FT                   /locus_tag="Alide_0291"
FT                   /gene_family="HOG000173945" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.11.1.5"
FT                   /codon_start="1"
FT                   /EC_number="1.11.1.5"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0196 cytochrome-c peroxidase; PFAM:
FT                   Di-haem cytochrome c peroxidase"
FT                   /db_xref="GI:319761023"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="GeneID:10102314"
FT                   /translation="MKQKSSPVRHAARFMLGAVSMAALLMAAPVRAQEPVQPIAGPKVT
FT                   SPAKVELGKKLWFDPRLSRSGFISCNSCHNLSMGGSDNLKTSIGDKWQKGPINSPTVLN
FT                   SSLNLAQFWDGRAKDLKEQAGGPIANPGEMAFTHGLAVDMLRSIPQYVAEFKKVFGHDK
FT                   LTIDEVTAAIAAFEETLVTPNARFDKWLKGDKKAINAQELRGYQLFKSSGCVACHNGPN
FT                   LGGNSFQKMGLVEPYKTDNPAEGRSAVTGNDAERFNFKVPTLRNVELTYPYFHDGAADT
FT                   LSQAVDTMGRLQLGKKFTGQENADIVAFLKTLTGDQPKIAMPILPPSSDKTKRPQPFE"
FT                   /product="cytochrome-c peroxidase"
FT                   /protein_id="YP_004124960.1"
     ATGAAACAGA AGTCCTCTCC CGTGCGCCAT GCCGCTCGCT TCATGCTGGG CGCGGTGTCC        60
     ATGGCAGCCC TGCTGATGGC TGCTCCCGTG CGCGCGCAGG AACCCGTGCA GCCAATCGCC       120
     GGCCCCAAGG TGACCAGCCC CGCCAAGGTC GAGTTGGGCA AGAAGCTGTG GTTCGACCCG       180
     CGCCTGTCGC GCTCGGGCTT CATCTCGTGC AACTCGTGCC ACAACCTGAG CATGGGTGGC       240
     TCGGACAACC TCAAGACCTC CATCGGCGAC AAGTGGCAGA AGGGCCCGAT CAACTCGCCC       300
     ACGGTGCTCA ACTCCAGCCT GAACCTCGCC CAGTTCTGGG ATGGCCGCGC CAAGGATCTG       360
     AAGGAGCAGG CCGGCGGTCC CATCGCCAAC CCGGGCGAGA TGGCCTTCAC GCACGGCCTG       420
     GCCGTGGACA TGCTGCGCTC CATCCCGCAG TACGTGGCCG AGTTCAAGAA GGTCTTCGGC       480
     CATGACAAGC TCACCATTGA CGAGGTGACG GCCGCCATCG CCGCCTTCGA GGAAACGCTG       540
     GTCACCCCCA ACGCGCGCTT CGACAAGTGG CTCAAGGGCG ACAAGAAGGC CATCAATGCG       600
     CAGGAACTGC GCGGCTACCA GCTCTTCAAG AGCTCCGGCT GCGTGGCCTG CCACAACGGC       660
     CCCAACCTGG GCGGCAACTC GTTCCAGAAG ATGGGCCTGG TCGAGCCCTA CAAGACGGAC       720
     AACCCGGCCG AGGGCCGCTC CGCCGTCACG GGCAACGACG CCGAGCGCTT CAACTTCAAG       780
     GTGCCGACGC TGCGCAACGT GGAACTGACG TACCCCTACT TCCACGACGG CGCCGCCGAC       840
     ACGCTGTCCC AGGCCGTGGA CACCATGGGC CGCCTGCAAC TGGGCAAGAA GTTCACCGGG       900
     CAGGAGAACG CCGACATCGT CGCCTTCCTG AAGACGCTGA CGGGCGACCA GCCCAAGATC       960
     GCCATGCCCA TCCTGCCGCC GTCGAGCGAC AAGACCAAGC GGCCCCAGCC GTTCGAATGA      1020
//

If you have problems or comments...

PBIL Back to PBIL home page