(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE286

ALDEN1_2.PE286       Location/Qualifiers
FT   CDS_pept        complement(325622..326236)
FT                   /locus_tag="Alide_0292"
FT                   /gene_family="HOG000125748" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /codon_start="1"
FT                   /product="glutathione s-transferase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   dia:Dtpsy_0197 glutathione S-transferase domain protein"
FT                   /db_xref="GI:319761024"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="GeneID:10102315"
FT                   /translation="MTTLTLYYAPGTCAQAVRIALEEAQAPYTPVRMDFASQQQRSPEY
FT                   LAINPKGRVPALVTEHGVLTETPALLAYVAQRFVQAGLAPADAFGFARMQEFNSYLAST
FT                   VHVAHAHRPRASRWADEPEAQAAMQRKVPANMTECFDVIERHYLGDGPWMLGEQYTVAD
FT                   GYLFTVAGWLKSDGVDIARFPKVHAHSQRMAARPAVQRALG"
FT                   /protein_id="YP_004124961.1"
     atgaccacgc taaccctgta ctacgccccc ggcacctgcg cccaggccgt acgcatcgcg        60
     ctggaggagg cccaggcgcc gtacaccccg gtgcgcatgg acttcgccag ccagcagcag       120
     cgctcgcccg aatacctggc catcaacccc aagggccgcg tgccggccct ggtcaccgag       180
     catggcgtgc tcaccgagac cccggccctg ctggcctacg tggcgcagcg ctttgtccag       240
     gccggcctgg cgcccgccga cgccttcggc ttcgcgcgca tgcaggagtt caacagctac       300
     ctggcgtcca ccgtgcacgt ggcgcacgct caccgcccgc gcgccagccg ctgggccgac       360
     gagcccgagg cccaggccgc catgcagcgc aaggtaccgg ccaatatgac cgagtgcttc       420
     gacgtgatcg agcggcacta tctgggcgac ggcccctgga tgctgggcga gcagtacacc       480
     gtggccgacg gctacctgtt caccgtggct ggctggctca agagcgacgg cgtggacatc       540
     gcgcgcttcc ccaaggtgca cgcccactcc cagcgcatgg cggcgcgccc ggcggtgcag       600
     cgggcgctgg gctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page