(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE287

ALDEN1_2.PE287       Location/Qualifiers
FT   CDS_pept        326367..327749
FT                   /locus_tag="Alide_0293"
FT                   /gene_family="HOG000218329" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /codon_start="1"
FT                   /product="DNA repair protein rada"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0199 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="GI:319761025"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="GeneID:10102316"
FT                   /translation="MAKDKTLYSCSECGASSPRWLGKCPGCGAWNTLIETVPDAGPGKN
FT                   RLSGAGQYAGLAQAQSVMPLAAIEATEVARTPSGIEELDRVLGGGVVEGGVVLIGGDPG
FT                   IGKSTLLLQAMDALQRVGLPTLYVTGEESGAQVALRSRRLGLEASQVNVLAEIQLEKIL
FT                   ATIEATQPAVAVIDSIQTIYSDQLTSAPGSVAQVRECAAHLTRLAKATGIAVVLVGHVT
FT                   KEGALAGPRVLEHMVDTVLYFEGDTHSSFRLVRAIKNRFGAVNEIGVFAMTERGLKGVA
FT                   NPSAIFLSQHSEPVPGSCVLVTLEGTRPLLVEIQALVDGGGPSPRRLSVGLERDRLAML
FT                   LAVLHRHAGVACADQDVFVNAVGGVRISEPAADLAVMLSITSSLRGRALPKGFIAFGEV
FT                   GLAGEVRPAPRGQERLKEAAKLGFTVAVVPKANAPKKPIPGLEIHAVERVDEAMAAVRG
FT                   LG"
FT                   /protein_id="YP_004124962.1"
     ATGGCCAAGG ACAAAACCCT CTACTCCTGC AGCGAATGCG GCGCGAGCAG CCCGCGCTGG        60
     CTCGGCAAAT GCCCGGGCTG CGGGGCCTGG AACACGCTGA TCGAGACCGT GCCCGATGCC       120
     GGCCCCGGCA AGAACCGTCT GAGCGGCGCG GGCCAGTATG CGGGCCTGGC GCAGGCGCAG       180
     TCGGTGATGC CGCTGGCCGC CATCGAGGCC ACCGAGGTGG CACGCACGCC CAGCGGTATC       240
     GAGGAGCTCG ACCGCGTGCT CGGCGGCGGC GTGGTCGAGG GCGGCGTGGT GCTCATCGGC       300
     GGCGACCCGG GCATCGGCAA GTCCACGCTG CTGCTGCAGG CCATGGACGC GCTGCAGCGC       360
     GTGGGCCTGC CCACGCTCTA CGTGACGGGC GAGGAGAGCG GTGCGCAGGT AGCGCTGCGC       420
     TCGCGCCGCC TGGGGCTGGA GGCGAGCCAG GTGAACGTGC TGGCCGAGAT CCAGCTGGAG       480
     AAGATCCTCG CCACCATCGA GGCCACGCAG CCCGCCGTGG CGGTGATCGA CTCCATACAG       540
     ACCATCTACT CCGACCAGCT CACGAGCGCG CCGGGCTCGG TGGCACAGGT GCGCGAATGC       600
     GCCGCCCACC TCACGCGGCT GGCCAAGGCC ACGGGCATCG CCGTGGTGCT GGTGGGCCAC       660
     GTGACCAAGG AGGGCGCGCT GGCCGGCCCG CGCGTGCTGG AGCACATGGT GGACACGGTG       720
     CTGTACTTCG AGGGCGACAC GCACAGCAGC TTCCGCCTGG TGCGCGCCAT CAAGAACCGC       780
     TTCGGCGCGG TGAACGAGAT CGGCGTGTTC GCCATGACCG AGCGGGGCCT CAAGGGCGTG       840
     GCCAACCCCA GCGCCATCTT CCTGTCGCAG CACAGCGAGC CCGTGCCCGG CAGCTGCGTG       900
     CTGGTCACGC TGGAGGGCAC GCGCCCGCTG CTGGTGGAGA TCCAGGCATT GGTCGATGGC       960
     GGCGGCCCGA GCCCGCGGCG CCTCTCGGTA GGCCTGGAGC GCGACCGCCT GGCCATGCTG      1020
     CTGGCGGTGC TGCACCGCCA TGCGGGCGTG GCCTGCGCGG ACCAGGACGT GTTCGTCAAT      1080
     GCCGTGGGCG GCGTGCGCAT CAGCGAGCCC GCGGCCGATT TGGCGGTGAT GCTGTCCATC      1140
     ACCAGCAGCC TGCGCGGGCG CGCGCTGCCC AAAGGCTTCA TCGCCTTCGG CGAGGTAGGC      1200
     CTGGCCGGCG AGGTGCGCCC CGCGCCGCGC GGCCAGGAGC GGCTGAAGGA GGCCGCCAAG      1260
     CTGGGCTTCA CCGTGGCCGT GGTGCCCAAG GCGAACGCGC CCAAAAAGCC CATCCCCGGC      1320
     CTGGAGATCC ACGCCGTGGA GCGCGTGGAC GAGGCCATGG CCGCCGTGCG CGGCCTGGGC      1380
     TGA                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page