(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE288

ALDEN1_2.PE288       Location/Qualifiers
FT   CDS_pept        complement(327753..328739)
FT                   /locus_tag="Alide_0294"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rmet_1769"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_1769 hypothetical protein"
FT                   /db_xref="GI:319761026"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102317"
FT                   /translation="MTTSSRRHAVLAGALAALALACGPAAQAQEGDFTRIVVGFAPGGA
FT                   ADSLARIYAEQLRQDGLGNVLVENKPGASSRLALDYVKKAPADGKTVFIGPSPMFTIFP
FT                   LTYKKLSYDPDKDLVPVALLTDVPTVIATAVNAPYKTMDQYVQWLKQHPAQGSLGLASI
FT                   GSAGHLGAFALSKELGLSVTPTPYRGATPMLVDVVSGNVSMGWDAVASMMPLYRGNKLH
FT                   FLGVSGTRRIKALPEVPTAFEQGYKQFEYATSWYGAYVSGATPEPVKARLQEAFIKASR
FT                   NPATAARLEDLGLEVVGKSGAEARERMLKERAAWSPIVKASGFEAQD"
FT                   /protein_id="YP_004124963.1"
     atgacgacat cctcgcgccg ccacgcggtg ctcgccggcg cgctggccgc cctggccctc        60
     gcatgcggcc cggccgcgca ggcccaggag ggcgacttca cgcgcatcgt ggtgggcttc       120
     gcgcccggcg gcgcggccga ttcgctcgcg cgcatctacg cggagcagct gcgccaggac       180
     ggcctgggca atgtgctggt ggagaacaag ccgggcgcgt cctcgcgcct ggccctcgac       240
     tacgtgaaga aggcgccggc cgacggcaag accgtcttca tcggtccctc gccgatgttc       300
     accatcttcc ccctgaccta caagaagctc agctacgacc ccgacaagga tctggtgccg       360
     gtggccctgc tgaccgacgt gcccaccgtc atcgccaccg ccgtcaacgc gccctacaag       420
     acgatggacc agtacgtaca gtggctcaag cagcatcccg cgcaggggag cctggggctg       480
     gcgtccatag gcagcgccgg ccacctgggc gccttcgcgc tgagcaagga gctgggcctg       540
     agcgtcacgc ccacgccgta ccgcggcgcc acgcccatgc tggtggacgt cgtgtcgggc       600
     aacgtttcca tgggctggga tgccgtcgcg agcatgatgc cgctgtaccg gggcaacaag       660
     ctgcatttcc tgggggtcag tggcacgcgc cgcatcaagg cccttcccga ggtgcccacc       720
     gcgttcgagc agggctacaa gcagttcgag tacgccacca gctggtacgg cgcctacgtg       780
     agcggcgcca cgcccgagcc ggtcaaggcg cgcctgcagg aggctttcat caaggcatcc       840
     cgcaacccgg ccacggccgc caggctcgag gacctcggac tggaggtcgt gggcaagtcc       900
     ggcgccgagg cccgggagcg catgctcaag gagcgcgccg cctggagccc catcgtcaag       960
     gcatcgggct tcgaggccca ggactga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page