(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE289

ALDEN1_2.PE289       Location/Qualifiers
FT   CDS_pept        complement(328764..330188)
FT                   /locus_tag="Alide_0295"
FT                   /gene_family="HOG000116697" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /codon_start="1"
FT                   /product="amidase"
FT                   /transl_table="11"
FT                   /note="PFAM: Amidase; KEGG: reh:H16_A1882 Asp-tRNA Asn /
FT                   Glu-tRNA Gln amidotransferase A subunit or related amidase"
FT                   /db_xref="GI:319761027"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="GeneID:10102318"
FT                   /translation="MPPELWKWPAAELARAIRGRHISPVEATTAILAHMAAQQPRLNCF
FT                   ITVCADQALAQARAAEGALMRGDALGALHGVPFSVKDIVNTRDVATTFGALPLRGNVPA
FT                   EDAVSVARLRRAGAILIGKTTTPEFGSKGFTDAPLFGATPNAWSPRHTCGGSSGGAAVA
FT                   VAAGMAPLAIATDGGGSTRIPAACNGVVGIKQTIGVVPHSQALDLFGNQTYVTPTARTV
FT                   LDTALMLDAMAGPHPCDPWSQGRAAVDHVQAVRAARDLRGKRFRYNVAPHGRRVSAQVE
FT                   QAFRQALLHIESLGGSVEPFEAQLDIEPLWRTVNHTVWRARFAPLVQQHGDALSATFRR
FT                   QIESAQDYSALDYQNAMFARSRLFHTVQGWLDDADFLVMPTLTRTALPLGTDIFDRMEI
FT                   DGAEMGDIRANWYPWTMPFNMTGHPAVSIPCGFDSERLPVGLQIVAPMFCDAQMLQAAA
FT                   CLEASFNLLQAWPDMS"
FT                   /protein_id="YP_004124964.1"
     atgccccccg aattgtggaa atggcccgcg gccgaactgg cccgcgccat acgcggcagg        60
     cacatctccc ccgtggaggc caccaccgcc atcctcgcgc acatggcggc gcagcagccc       120
     cggctgaact gcttcatcac cgtgtgcgcg gaccaggcgc tggcgcaggc ccgggccgcc       180
     gagggcgccc tcatgcgcgg cgacgccctg ggcgcgctac acggcgtgcc gttctccgtg       240
     aaggacatcg tcaacacccg ggacgtcgcc acgaccttcg gggcgctccc cctgcgcggc       300
     aacgtccccg ccgaggacgc cgtctccgtg gcccggttgc gccgcgccgg cgcgatcctg       360
     atcggcaaga ccacgacgcc cgagttcggc tccaagggtt tcaccgacgc gccgctgttc       420
     ggcgccacgc ccaacgcatg gagcccccgc cacacctgcg gcggcagcag cgggggcgcg       480
     gcggtggccg tcgccgccgg catggcgccg ctggccatcg ccaccgatgg cggcggctcc       540
     acgcgcatcc ccgccgcctg caacggcgtg gtgggcatca agcagaccat cggcgtggtg       600
     ccgcacagcc aggcactgga cctcttcggc aaccagacct acgtcacgcc gaccgcgcgc       660
     accgtgctgg acacggcgct gatgctcgac gcgatggccg gcccccaccc gtgcgacccc       720
     tggtcccagg gacgcgcggc tgtcgatcac gtgcaggccg tgcgggcggc gcgtgacctg       780
     cgcggcaagc gctttcgcta caacgtcgcg ccgcacgggc gccgcgtgtc ggcgcaggtg       840
     gagcaggcgt tccggcaggc gctgctccac atcgagtcgc tgggaggcag tgtggagccg       900
     ttcgaggcgc agctggacat cgagcccctc tggcgcacgg tgaaccacac ggtctggcgc       960
     gcccgcttcg cgccgctggt gcagcagcat ggcgacgccc tgagcgccac gttccggcgc      1020
     cagatcgaga gcgcgcagga ctacagcgcg ctcgactacc agaacgcgat gttcgcgcgc      1080
     tcccgacttt ttcacaccgt gcagggctgg ctggacgacg cggacttcct agtcatgccg      1140
     acgctcacgc gcacggcgct gccgctgggc accgacatct tcgaccgcat ggagatcgac      1200
     ggcgccgaga tgggcgacat ccgcgcgaac tggtacccct ggaccatgcc gttcaacatg      1260
     acgggccatc ccgccgtcag catcccgtgc ggcttcgatt ccgagcggct gccggtgggc      1320
     ctgcagatcg tcgcgcccat gttctgcgat gcgcagatgc tgcaggcggc ggcctgcctg      1380
     gaggcctctt tcaacctgct gcaggcctgg cctgacatgt cataa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page