(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE29

ALDEN1_2.PE29        Location/Qualifiers
FT   CDS_pept        complement(37432..38037)
FT                   /locus_tag="Alide_0029"
FT                   /gene_family="HOG000224876" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09411"
FT                   /codon_start="1"
FT                   /product="lipid a 3-o-deacylase-related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Lipid A 3-O-deacylase-related; KEGG:
FT                   dia:Dtpsy_0024 hypothetical protein"
FT                   /db_xref="GI:319760767"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="GeneID:10102052"
FT                   /translation="MQPLVSPGLLCLSGAGRHGRRPLLSATAACLLCAIPPAFAQQAAH
FT                   SPSVYLQASRAQHGTDAVTLGATLPFGTWSMPLWGGELRGHWDMYLSRWSFDGIAGHDS
FT                   TLVLGVKPTLRLRPDQGRSAWFWEAGVGGTLANHRYRTAEREFSTRFNFASYLGVGINL
FT                   GARRQHELLLSVEHLSNASIKKPNPGLNFVHLRYALHF"
FT                   /protein_id="YP_004124704.1"
     atgcaacctc tcgtctcccc tggtctcctt tgcttatccg gcgcaggcag gcacggccgc        60
     cgccctcttc tctcggccac ggccgcctgc ctgctttgcg ccattccccc cgccttcgcg       120
     cagcaggctg cgcattcccc gtcggtctac ctgcaggcca gccgcgcgca gcacggcacc       180
     gacgccgtca cgctcggcgc caccctgccc ttcggcacat ggagcatgcc gctgtggggc       240
     ggcgagctgc gcgggcattg ggacatgtac ctgagccgct ggtccttcga cggcatcgcc       300
     ggccacgaca gcaccctggt gttgggcgtc aagcccacgc tgcgcctgcg cccggaccag       360
     ggccgctccg cgtggttctg ggaggccggc gtgggcggca ccctggccaa ccatcgctac       420
     cgcacggcgg agcgcgagtt cagcacgcgc ttcaacttcg cctcctacct gggcgtgggc       480
     atcaacctcg gcgcgcggcg ccagcacgag ctgctgctga gcgtggagca tctctccaac       540
     gccagcatca agaaacccaa ccccgggctg aacttcgtgc acctgcgcta cgcgctgcac       600
     ttctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page