(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE292

ALDEN1_2.PE292       Location/Qualifiers
FT   CDS_pept        331761..331967
FT                   /locus_tag="Alide_0298"
FT                   /gene_family="HOG000263985" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10276"
FT                   /codon_start="1"
FT                   /product="zinc finger, chcc-type"
FT                   /transl_table="11"
FT                   /note="PFAM: Zinc finger, CHCC-type; KEGG: ajs:Ajs_0183
FT                   hypothetical protein"
FT                   /db_xref="GI:319761030"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="GeneID:10102321"
FT                   /translation="MPQAIVELLAKDLDGNGGVHCPNPKADMKLWNGHPRVFLEIAHQG
FT                   QAQCPYCGTLYRLKAGEIVHAGH"
FT                   /protein_id="YP_004124967.1"
     ATGCCTCAAG CAATCGTCGA ACTGCTCGCC AAGGACCTGG ACGGCAATGG GGGCGTGCAC        60
     TGCCCCAACC CCAAGGCGGA CATGAAGCTG TGGAACGGCC ATCCCAGGGT ATTCCTCGAG       120
     ATCGCCCACC AGGGACAGGC GCAGTGCCCG TATTGCGGCA CGCTGTACCG CCTCAAGGCG       180
     GGTGAGATTG TTCACGCGGG TCATTGA                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page