(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE295

ALDEN1_2.PE295       Location/Qualifiers
FT   CDS_pept        334499..335545
FT                   /locus_tag="Alide_0301"
FT                   /gene_family="HOG000224920" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family 2"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ajs:Ajs_0186 glycosyl transferase family protein"
FT                   /db_xref="GI:319761033"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:10102324"
FT                   /translation="MKDADAPWLSILVPVYDVQDYLAECIGSVMEQLAQLPDGGAGVEV
FT                   LVLDDASTDGSRALMDALAARWPGRLALMHHARNQGLSAARNTMIGAARGEYLWFLDSD
FT                   DKLLPGALAGLQAAVRRHAPDAVLCDFAVWRERPRLKHRLRGEAHRATFAGPAGGPFHD
FT                   RAALLAGLFMTGQLHAWSKITRRALWGADLRFPPGRYFEDMATMPLALLRARSHCYLPE
FT                   PWVAYRQRGSSILATMTLPKALDQSQALGAFAQALRAAEAAGDMPAHADLHFALAHQCA
FT                   RSLTGAARFLERAALPVAEREAAAWRLRDDFAAASPLAAEALLRAYARRGWWLRAHRLR
FT                   RAWSTVSA"
FT                   /protein_id="YP_004124970.1"
     ATGAAGGATG CGGACGCTCC CTGGCTCAGC ATCCTCGTGC CCGTCTACGA CGTGCAGGAC        60
     TACCTGGCCG AGTGCATCGG GTCGGTGATG GAGCAGCTGG CGCAGCTGCC TGACGGCGGC       120
     GCGGGCGTGG AGGTGCTGGT GCTCGACGAC GCGTCCACCG ACGGCTCGCG CGCCCTCATG       180
     GACGCGCTGG CCGCGCGCTG GCCCGGCCGC CTGGCCCTGA TGCACCACGC GCGCAACCAG       240
     GGGCTGAGCG CGGCGCGCAA CACCATGATC GGCGCGGCCC GCGGCGAGTA CCTGTGGTTC       300
     CTCGACTCCG ACGACAAGCT GCTGCCCGGC GCGCTGGCGG GCCTGCAGGC CGCCGTGCGG       360
     CGCCACGCGC CCGACGCGGT GCTGTGCGAC TTCGCGGTCT GGCGCGAGCG CCCGCGCCTC       420
     AAGCACCGGC TGCGCGGCGA GGCGCACCGC GCCACCTTCG CCGGGCCCGC AGGCGGGCCG       480
     TTCCACGACC GGGCGGCGCT GCTGGCCGGG CTGTTCATGA CGGGCCAGCT GCACGCCTGG       540
     TCCAAGATCA CGCGGCGCGC GCTGTGGGGC GCGGACCTGC GCTTTCCGCC GGGCCGCTAC       600
     TTCGAAGACA TGGCCACCAT GCCCCTGGCC CTGCTGCGCG CGCGCAGCCA TTGCTACCTG       660
     CCCGAACCCT GGGTGGCCTA CCGCCAGCGC GGCAGCAGCA TCCTGGCCAC CATGACGCTG       720
     CCCAAGGCGC TGGATCAGTC GCAGGCGCTG GGCGCGTTTG CCCAGGCCCT GCGGGCGGCC       780
     GAGGCCGCGG GCGACATGCC CGCCCATGCG GATCTGCATT TCGCGCTGGC CCACCAATGC       840
     GCGCGCAGCC TCACGGGCGC GGCGCGCTTC CTGGAGCGGG CAGCGCTGCC CGTGGCCGAG       900
     CGCGAGGCCG CGGCGTGGCG GCTGCGCGAC GACTTCGCTG CGGCATCGCC CCTGGCCGCG       960
     GAGGCGCTGC TGCGCGCCTA TGCGCGGCGC GGCTGGTGGC TGCGCGCCCA CCGGCTGCGG      1020
     CGCGCCTGGA GCACCGTGTC CGCATGA                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page