(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE297

ALDEN1_2.PE297       Location/Qualifiers
FT   CDS_pept        complement(336585..337649)
FT                   /locus_tag="Alide_0303"
FT                   /gene_family="HOG000123287" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /codon_start="1"
FT                   /product="2-nitropropane dioxygenase npd"
FT                   /transl_table="11"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   ajs:Ajs_0188 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="GI:319761035"
FT                   /db_xref="GO:0018580"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="GeneID:10102326"
FT                   /translation="MTTTLLQRLNISLPIIQGPMTGSDTPQLAAAVSQAGGLGMLGCGM
FT                   RSPEAMAQAAAAVRAATGKPFGMNLFVLETPRPDAAEVAAAMDRLAPLYARFGLPPEAP
FT                   ARWCEDFAAQFDALIAARPAVASFTFGILSAAQVRRIQSEAGSFVIGTATTPAEALAWQ
FT                   EVGADAVVASGMEAGGHRGTFQGDWEGSLIGTLPLVPTCVDTLKIPVIAAGGIMDGRGI
FT                   AAAQALGAQAVQMGTAFLACPESSIVPAQRAAMAAAQATDTRLTRIFSGRPARGILNQA
FT                   MRSLQPQEADIPAYPVQNALMGPIRRAAAQAGDAGHIALWAGQGVGAARALPAGELVAL
FT                   LAQEWRAALQRLQA"
FT                   /protein_id="YP_004124972.1"
     atgaccacca cactgctgca acgcctgaac atctccctgc ccatcatcca gggccccatg        60
     acgggctccg acacgccgca gctggcggcc gccgtgtcgc aggccggcgg cctgggcatg       120
     ctgggctgcg gcatgcgctc gcccgaggcc atggcccagg cggcggccgc cgtgcgcgcc       180
     gccaccggca agcccttcgg gatgaacctg ttcgtgctgg aaacaccccg gcccgacgct       240
     gccgaagtgg ccgccgccat ggacaggctg gcgccgctgt acgccaggtt cggcctcccg       300
     cccgaggcgc cggcgcgctg gtgcgaagac ttcgccgcgc agttcgatgc gctcatcgca       360
     gcccggcccg ccgtggccag cttcaccttc ggcatcctga gcgcggccca ggtgcgccgc       420
     atccagagcg aagccggcag cttcgtcatc ggcacggcca ccaccccggc cgaggccctg       480
     gcctggcagg aagtgggcgc ggatgcggtg gtcgccagcg gcatggaggc cggcggccac       540
     cgcggcacct tccagggcga ctgggaaggc agcctgatcg gcaccctgcc cctggtgccg       600
     acctgcgtgg acacgctgaa gattcccgtg atcgccgccg gcggcatcat ggacgggcgc       660
     ggcatcgccg ccgcgcaggc gctgggcgcg caggcggtgc agatgggcac ggccttcctc       720
     gcctgccccg agtcatcaat agtccccgcg cagcgcgccg caatggccgc cgcccaggcc       780
     acggacacgc gcctgacgcg catcttctcg ggccgcccgg cgcgcggcat cctcaaccag       840
     gcgatgcggt cgctgcagcc gcaagaggcg gacatccccg cctaccccgt gcagaacgcc       900
     ctcatgggcc ccatccgccg cgccgccgcg caagccgggg acgccggaca catcgcgctg       960
     tgggccggcc agggcgtggg cgcggcgcgc gcgctgccgg cgggcgagct ggtggcgctg      1020
     ctggcgcagg aatggcgggc cgcgctgcag cggctgcagg cttga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page