(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE299

ALDEN1_2.PE299       Location/Qualifiers
FT   CDS_pept        338568..339797
FT                   /locus_tag="Alide_0305"
FT                   /gene_family="HOG000259245" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0209"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0209 protein of unknown function
FT                   DUF1228"
FT                   /db_xref="GI:319761037"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="GeneID:10102328"
FT                   /translation="MRATPSWSEQPRAVTWAGMLALAVAMGVGRFAFTPLLPMMLHDGV
FT                   LTLAEGSWLATANYVGYLAGALACMALPWVAPAVYERWHPARLARAGLVATVLLTVAMA
FT                   LPLPGAWPLLRFAAGVASAFVLLNVAAWCMVRLTALGRPSMGGLVFCGPGVGIALTGLA
FT                   ASAMVAAQWRASTGWVVCGLLSVLLCAVVWPVVRGRAAQARAGAPHPHAPARAPGGGTV
FT                   LARGVHALAYGLAGLGYIVTATFLPVIARAALPAGSLWPDLFWPMFGVGVTVGAALSTR
FT                   ANAAWDRRWLLCATYGMQALGIALGLWWPTPAGFALSSCLVGLPFTAITFYGLQEARRL
FT                   WPQSADSFASLITAVYGLGQIMGPPMVAWLLARGGQAQGFAQGLALAAGALVVGAAMYA
FT                   ASAWRWPLVR"
FT                   /protein_id="YP_004124974.1"
     ATGCGCGCTA CCCCCTCCTG GTCCGAGCAG CCCCGCGCCG TGACCTGGGC CGGCATGCTG        60
     GCGCTGGCCG TCGCCATGGG CGTGGGGCGC TTCGCCTTCA CGCCGCTGCT GCCCATGATG       120
     CTGCACGACG GCGTGCTCAC CCTGGCCGAG GGCAGCTGGC TGGCCACGGC CAACTACGTC       180
     GGCTACCTGG CGGGCGCGCT GGCCTGCATG GCGCTGCCCT GGGTGGCGCC CGCCGTGTAC       240
     GAGCGCTGGC ACCCGGCGCG GCTGGCGCGC GCGGGGCTGG TGGCCACGGT ACTGCTGACG       300
     GTGGCCATGG CGCTGCCGCT GCCCGGCGCC TGGCCGCTGC TGCGCTTCGC CGCCGGCGTG       360
     GCCAGCGCCT TCGTGCTGCT CAACGTGGCG GCCTGGTGCA TGGTGCGCCT CACGGCGCTG       420
     GGCCGCCCGT CCATGGGCGG GCTGGTCTTC TGCGGGCCGG GCGTGGGTAT CGCGCTCACG       480
     GGCCTGGCGG CCAGCGCCAT GGTGGCCGCG CAGTGGCGCG CGTCGACGGG CTGGGTGGTG       540
     TGCGGGCTGC TGTCGGTGCT GCTGTGCGCG GTGGTCTGGC CCGTGGTGCG GGGCCGCGCG       600
     GCCCAGGCCC GGGCGGGCGC GCCGCACCCG CACGCGCCGG CGCGCGCGCC GGGCGGGGGC       660
     ACGGTGCTGG CGCGCGGCGT GCACGCGCTG GCCTACGGGC TGGCGGGGCT GGGCTATATC       720
     GTCACCGCCA CCTTCCTGCC GGTGATCGCG CGGGCCGCGC TGCCGGCCGG CTCGCTCTGG       780
     CCCGACCTGT TCTGGCCCAT GTTCGGCGTG GGCGTCACCG TGGGGGCCGC CCTGAGCACG       840
     CGCGCGAACG CGGCGTGGGA CCGGCGCTGG CTGCTGTGCG CGACCTATGG CATGCAGGCC       900
     CTGGGCATCG CGCTGGGCCT GTGGTGGCCC ACGCCGGCGG GGTTCGCGCT CAGCAGCTGC       960
     CTGGTGGGCC TGCCGTTCAC CGCCATCACC TTCTATGGCC TGCAGGAGGC GCGGCGCCTG      1020
     TGGCCGCAGT CTGCCGACAG CTTTGCCAGC CTGATCACGG CGGTCTACGG CCTGGGGCAG      1080
     ATCATGGGTC CGCCCATGGT GGCCTGGCTG CTCGCGCGCG GCGGCCAGGC GCAGGGCTTT      1140
     GCCCAGGGGC TGGCGCTGGC CGCGGGGGCG CTGGTGGTGG GGGCGGCCAT GTATGCCGCA      1200
     TCGGCCTGGC GCTGGCCCTT GGTGCGCTGA                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page