(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE30

ALDEN1_2.PE30        Location/Qualifiers
FT   CDS_pept        complement(38152..38745)
FT                   /locus_tag="Alide_0030"
FT                   /gene_family="HOG000220307" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0007"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0007 hypothetical protein"
FT                   /db_xref="GI:319760768"
FT                   /db_xref="GeneID:10102053"
FT                   /translation="MTRFKITQRLACTALAAALAGMAIPSMAQPAPGAGPTAEQAQRQG
FT                   PRAMTPEQRQQFMLQRAEAFKQKLQLTPAQEPAWNTFMQSMRPDAGSRKAWLEMKDMDK
FT                   LTTPERIDRMRAIRAQRAAEMDRRGDAVKAFYATLTPAQQKTFDAEGTRMYGRRGAQWD
FT                   RHMGDHKGDWRGPRNGMHRHGPGPMPAPGAPAAQ"
FT                   /protein_id="YP_004124705.1"
     atgacccgtt tcaagatcac ccagcgcctg gcctgcaccg ccctggcggc cgcgttggcc        60
     ggcatggcca tcccgtccat ggcccaaccc gcgccaggcg ccggccccac cgcggaacag       120
     gcgcagcgcc agggtccgcg cgccatgaca cccgagcagc gccagcagtt catgctccag       180
     cgcgccgagg ccttcaagca gaagctgcag ctcacgcccg cgcaggagcc ggcctggaac       240
     accttcatgc agtccatgcg gccggacgcc ggatcgcgca aggcctggtt ggaaatgaag       300
     gacatggaca agctcaccac ccccgagcgc atcgaccgca tgcgggccat ccgcgcgcag       360
     cgcgcggccg agatggaccg ccgcggcgac gcggtgaagg ccttctacgc cacgctgacg       420
     ccggcccagc aaaagacctt cgacgccgag ggcacgcgca tgtatggccg gcgcggcgcc       480
     caatgggaca ggcacatggg cgatcacaag ggcgactggc gtggccccag gaacggcatg       540
     caccgccatg gcccgggccc catgccggca cccggcgcgc ccgcggcgca atga             594
//

If you have problems or comments...

PBIL Back to PBIL home page