(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE300

ALDEN1_2.PE300       Location/Qualifiers
FT   CDS_pept        complement(339801..340520)
FT                   /locus_tag="Alide_0306"
FT                   /gene_family="HOG000051122" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /codon_start="1"
FT                   /product="mosc domain containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   dia:Dtpsy_0210 MOSC domain containing protein"
FT                   /db_xref="GI:319761038"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="GeneID:10102329"
FT                   /translation="MNATPPQPLGRLRAVLTGRALPYTRPGSRSAIAKQARGGPVGAGP
FT                   LGLDGDEQGDPRVHGGPDKAVHCYAWAQYAPWRQELAGNAAAQALLEQPGAFGENFSLD
FT                   DLQESQVCIADQWQIGSARFEVSQGRQPCWKLNDRFGVPDMALRVQSSLRTGWYLRVLQ
FT                   GGQVQAGDQVWLLARPYPEWPITRLLRAIAERDCTPATLRQILALPLPPSWHKLFSCRL
FT                   ENASAEDWTSRLVGRQP"
FT                   /protein_id="YP_004124975.1"
     atgaacgcca cgcccccaca gcccctgggc cggctgcgcg ccgtgctcac cggccgcgcc        60
     ctgccctaca cccgccccgg cagccgcagc gccatcgcca agcaggcgcg cggcggcccg       120
     gtcggcgctg gcccgctggg cctggatggc gacgagcagg gcgacccgcg cgtgcacggc       180
     ggccccgaca aggccgtgca ctgctacgcc tgggcccagt acgcgccctg gcggcaagag       240
     cttgcgggca acgccgcggc gcaagccctg ctggagcagc ccggcgcgtt cggcgagaac       300
     ttcagcctgg acgacctgca ggaatcccag gtctgcatcg cggaccagtg gcagatcggc       360
     agcgcgcgct tcgaggtcag ccagggccgc cagccctgct ggaagctgaa cgaccgcttc       420
     ggcgtgcccg acatggcgct gcgcgtgcaa agcagcctgc gcaccggctg gtacctgcgc       480
     gtgctgcagg gcggccaggt gcaggcgggc gaccaggtgt ggctgctggc gaggccctac       540
     cccgagtggc ccatcacgcg cctgctgcgc gccattgccg agcgcgactg cacgcccgcg       600
     acgctgcgcc agatcctggc cctgccgctg ccgccctcgt ggcacaagct gttcagctgc       660
     cggctggaga acgccagcgc agaggactgg acctcccggc tggtcggcag gcagccctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page