(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE301

ALDEN1_2.PE301       Location/Qualifiers
FT   CDS_pept        complement(340517..341077)
FT                   /locus_tag="Alide_0307"
FT                   /gene_family="HOG000223522" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /codon_start="1"
FT                   /product="alkyl hydroperoxide reductase/ thiol specific
FT                   antioxidant/ mal allergen"
FT                   /transl_table="11"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: dia:Dtpsy_0211 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="GI:319761039"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="GeneID:10102330"
FT                   /translation="MNGTYHPPAPPLQVAQWFNTPQPLTLKALRGRVVVLHAFQMLCPG
FT                   CVEHGIPQARRVHEAFPQDRLVVIGLHTVFEHHDVQGGAAALQAFMHEYRLRFPIGLDQ
FT                   PDPQRTIPRTMHSLALQGTPSLVVLDPQGRVRLHHFGHLDDLRLGTLLGQLLAEPVPAA
FT                   ATPAQAAAGCDDNGCPRPDMPPP"
FT                   /protein_id="YP_004124976.1"
     atgaacggca cctatcaccc gcccgcgccg ccgctgcagg tggcgcaatg gttcaacacg        60
     ccgcagccgc tcacgctgaa ggcgctgcgc gggcgcgtcg tagtgctaca cgcgttccag       120
     atgctgtgcc cgggctgcgt ggagcacggc ataccgcagg cgcggcgcgt gcacgaggcg       180
     ttcccgcagg accggctcgt cgtgatcggt ctgcacacgg tgttcgagca ccacgacgtg       240
     cagggcggcg cggcggcgct gcaggccttc atgcacgaat accgcctgcg ctttcccatc       300
     ggcctggacc agcccgaccc gcagcgcacc attccacgca ccatgcacag cctggcgctg       360
     cagggcacgc ccagcctggt ggtgctggac ccgcagggcc gcgtgcgcct gcaccacttc       420
     gggcacctgg acgacctgcg cctgggcacg ctgctgggcc agctgctggc cgagcccgtg       480
     cctgccgccg ccacgccggc ccaggccgcc gccggctgcg acgacaacgg ctgcccgcgc       540
     cccgacatgc ccccgccatg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page