(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE302

ALDEN1_2.PE302       Location/Qualifiers
FT   CDS_pept        complement(341096..341590)
FT                   /locus_tag="Alide_0308"
FT                   /gene_family="HOG000225989" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /codon_start="1"
FT                   /product="activator of hsp90 atpase 1 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: oca:OCAR_5014 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="GI:319761040"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="GeneID:10102331"
FT                   /translation="MSTADIGTLQRTATGFEGRLTRRLDHGADAVWRMLTDPQAMAQWL
FT                   APGNIELCTGGAVRIDFVDSGIVIDSRVTAFEAQRVLAYSWSSGNEPERPMRWELAPAG
FT                   EGTALTLTLQIPAGEDAAKACAGFEGHLDMLAAALEGVPIKFPFERFLQARSAYNAQLA
FT                   G"
FT                   /protein_id="YP_004124977.1"
     atgagcacag ccgacatcgg caccctgcaa cgcacggcca cgggttttga aggccgcctg        60
     acacgccggc tcgaccacgg cgcggacgcc gtctggcgca tgctgaccga cccgcaggcc       120
     atggcgcaat ggctggcgcc cggcaacatc gagctgtgca ccggcggcgc cgtgcgcatc       180
     gacttcgtcg acagcggcat cgtcatcgac agccgcgtca ccgccttcga ggcgcagcgc       240
     gtgctggcct actcctggag cagcggcaac gaacccgagc gccccatgcg ctgggagctg       300
     gcccccgccg gcgagggcac cgcattgacc ctgacgctgc aaattcccgc cggcgaggac       360
     gccgccaaag cctgcgccgg cttcgagggc cacctggaca tgctggccgc cgccctggag       420
     ggcgtgccga tcaagttccc gttcgagcgc ttcttgcagg cgcgcagcgc ctacaacgcg       480
     cagttggcgg gctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page