(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE304

ALDEN1_2.PE304       Location/Qualifiers
FT   CDS_pept        complement(342173..343144)
FT                   /locus_tag="Alide_0310"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_0012"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_0012 hypothetical protein"
FT                   /db_xref="GI:319761042"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102333"
FT                   /translation="MMTRRSIHTAIVGALALVSAAAHAQSYPARPVKLIVPYAAGGPTD
FT                   TFARALADAWGKKLGQVLVVENRTGAGTLVGTDAVAKAQPDGYTILLTTVAHAVNPSIH
FT                   DKMPYRTVEDFAPVGMAAKAPLVIVVNKNFPAQNLQEFIGYIKDHPGKVNYGSAGVGSA
FT                   PHLGVELLNYMTGSKTEHVPYRGSAPAMQDVIGGHLAFMMDSAPTGLAQVKAGTVRLIA
FT                   TTMGQRLPQTPDTPAVAEVVPKYEAYTWNAVFAPAQTPAPVIAKLNTSLKEALQDPGLQ
FT                   KQAYDMGLVLEKNPQPQALAAFLGGELAKWGQVAKAAKMTAN"
FT                   /protein_id="YP_004124979.1"
     atgatgacac gtcgatcgat ccacaccgcc atcgttggtg cattggcatt ggtctcggcc        60
     gcagcgcatg cgcaaagcta cccggcacgc cccgtgaaac tgattgtgcc ctacgcagca       120
     ggaggcccga ccgatacctt tgcccgcgcc ctggcggacg catggggcaa gaagctgggg       180
     caagtgctgg tcgtggagaa ccgcacgggc gcaggcacgc tggtgggcac cgatgccgtg       240
     gccaaggccc agccggacgg ctacaccatc ctgctgacca cggtggcgca cgccgtgaac       300
     cccagcatcc acgacaagat gccgtacagg accgtggagg acttcgcccc cgtgggcatg       360
     gcggcaaagg cgccgctggt gatcgtggtg aacaagaatt tcccggcgca gaacctgcag       420
     gaattcatcg gctacatcaa ggatcacccg ggcaaggtga actacggatc ggcaggcgtc       480
     ggcagcgcgc cccatctggg cgtcgaactg ctgaactaca tgaccggctc caagaccgag       540
     catgtgccct accgcggcag cgcgcctgcc atgcaggacg tgatcggcgg gcacctggcc       600
     ttcatgatgg acagcgcccc caccggcctg gcccaggtga aggcgggcac ggtgcgcctg       660
     atcgccacga cgatggggca gcgcctgccc cagacgcccg acacgccggc cgtggcagag       720
     gtcgtgccca agtacgaggc ctacacctgg aacgcggtgt ttgctccagc ccagaccccg       780
     gcgccggtga ttgcaaagct caacaccagc ctgaaggaag cgctgcagga tcccggcctg       840
     caaaagcagg cctacgacat gggcctggta ttggagaaga acccccagcc gcaggcgctg       900
     gccgccttcc tcggcggcga gctggccaag tggggccaag tggccaaggc cgcgaaaatg       960
     acggcgaatt ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page