(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE308

ALDEN1_2.PE308       Location/Qualifiers
FT   CDS_pept        complement(346757..347467)
FT                   /locus_tag="Alide_0314"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="response regulator receiver"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0194 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="GI:319761046"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:10102337"
FT                   /translation="MNSQLLMIEDDHRLAQMVGEYLGQSGLQVTHMADGTSGLAQLQGS
FT                   ELPDLVILDLMLPDMDGLEVCRRIRALPGAAAQVPVLMLTAKGDPMDRVIGLEIGADDY
FT                   LPKPFEPRELLARIRAILRRREAGAQPPANHLLRFGSLEIDRDARTITVGGEPAELTSY
FT                   QFDLLVTMAERAGRVLTRDQIMEAVRGRELEAFDRSIDVHMGRIRAAIEADPKNPRRIL
FT                   TVRGVGYVFAKQQD"
FT                   /protein_id="YP_004124983.1"
     atgaactcgc aactgctgat gatcgaagac gaccaccgcc tcgcgcagat ggtgggcgaa        60
     tacctcggcc agtccgggtt gcaggtgacg cacatggccg atggcacgag cggcctggcg       120
     cagctgcagg gcagcgagct gcccgacctg gtgatcctgg acctgatgct gcccgacatg       180
     gacggcctgg aggtgtgccg gcgcatacgc gcgctgccgg gcgcggccgc ccaggtgcca       240
     gtgctgatgc tcaccgccaa gggcgacccc atggaccgcg tgatcggcct ggagatcggc       300
     gccgacgact acctgcccaa gcccttcgag ccacgcgagc tgctcgcgcg catacgcgcc       360
     atcctgcgcc ggcgcgaggc cggcgcccag cccccggcca accatctgct gcgcttcggc       420
     agcctggaga tcgaccgcga cgcgcgcacc atcaccgtgg gcggcgagcc agcggagctg       480
     acctcctacc agttcgacct gctggtcacc atggccgagc gcgcgggccg cgtgctcacg       540
     cgcgaccaga tcatggaggc cgtgcgcggg cgcgagctcg aagccttcga ccgcagcatc       600
     gacgtgcaca tgggccgcat ccgcgccgcc atcgaggccg accccaagaa cccgcgccgc       660
     attctcaccg tgcgcggcgt gggctacgtg ttcgccaagc agcaggattg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page