(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE309

ALDEN1_2.PE309       Location/Qualifiers
FT   CDS_pept        complement(347563..348921)
FT                   /locus_tag="Alide_0315"
FT                   /gene_family="HOG000217209" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily mfs_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dia:Dtpsy_0214 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:319761047"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:10102338"
FT                   /translation="MVAVRIIPRMPDSSSAAPARRSWRQAWLVYLEPASLRMLALGFSA
FT                   GLPLLLVLGTLSFRLREAGIDRTTIGYLSWVGLAYAFKWVWSPLVDRLPLPLLTRALGR
FT                   RRSWLLLAQGMVMAGLVGMALVDPRATLGPMVWCALLVAFGSATQDIALDAFRIESADA
FT                   DRQAALAATYQTGYRLAMIWAGAGVLWVAARAEVAGLAGYQAGAWAAAYLVMAASMLVG
FT                   TATVLLSPEPTPRPLAPARNLGEWLRGAVVEPFADFIRRYRWQAALILALIAVYRISDV
FT                   VMGIMANPFYVDMGYTKDEVAAVTKVFGVVMTLAGAFVGGVLSMRLGVMRVLMLGAVLS
FT                   ALSNLLFAWLGQRGHDLTGLVLVVSADNLAGGIASAAFIAYLSGLTNVQYSATQYALFS
FT                   SMMLLLPKWLAGFSGRFVDAHGYAAFFTGTALLGLPVLLLVALAARAKTASSV"
FT                   /protein_id="YP_004124984.1"
     atggtagcgg tgcggataat cccccgcatg cccgattcct cttccgccgc ccccgcccgc        60
     cgctcctggc gccaggcctg gctcgtctac ctggagcccg ccagcctgcg catgctcgcg       120
     ctgggcttct ccgccgggct gccgctgctg ctggtgctgg gcacgctgtc gttccggctg       180
     cgcgaggcgg gcatcgaccg cacgacgatc ggctacctct cgtgggtggg cctggcctat       240
     gcgttcaagt gggtctggtc gccgctggtg gaccggctgc cgctgccgct gctcacgcgt       300
     gccctggggc ggcggcgcag ctggctgctg ctggcgcagg gcatggtgat ggccgggctg       360
     gtgggcatgg cgctggtgga cccgcgcgcc acgctggggc ccatggtgtg gtgcgcgctg       420
     ctggtggcct tcggctcggc cacgcaggac atcgcgctgg acgcgttccg catcgagtcg       480
     gccgacgccg accgccaggc cgccctggcc gccacctacc agacgggcta ccgcctggcc       540
     atgatctggg ccggcgccgg cgtgctgtgg gtggcggcgc gcgcagaggt ggcgggcctt       600
     gccggctacc aggccggcgc ctgggccgcg gcctacctgg tcatggcggc ctcgatgctg       660
     gtgggcacgg cgacggtgct gctctcgccc gaacccacgc cccgcccact ggcgcccgcg       720
     cgcaacctgg gcgagtggct gcgcggcgcg gtggtggagc cgttcgccga cttcatccgg       780
     cgctaccgct ggcaggcggc gctgatcctg gcgctcatcg ccgtctaccg catcagcgac       840
     gtggtgatgg gcattatggc caacccgttc tacgtggaca tgggctacac caaggacgag       900
     gtggccgccg tgaccaaggt cttcggcgtg gtcatgacgc tggcgggcgc cttcgtgggc       960
     ggcgtgctct cgatgcgcct gggcgtgatg cgcgtgctga tgctgggcgc ggtgctcagt      1020
     gcgctcagca acctgctgtt cgcgtggctg ggccagcgcg ggcacgacct cacgggactg      1080
     gtgctggtgg tctcggccga caacctggcc ggcggcatcg cctcggcggc gttcatcgcc      1140
     tacctgtcgg gcctgaccaa cgtgcagtac tcggccacgc agtacgcgct gttcagttcc      1200
     atgatgctgc tgctgcccaa atggctggcg ggcttctcgg gccggttcgt ggacgcgcac      1260
     ggctacgccg cgttcttcac gggcacggcc ctgctgggcc tgccggttct gctgctggtg      1320
     gcactggcgg caagagccaa aactgcctcc agcgtttga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page