(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE31

ALDEN1_2.PE31        Location/Qualifiers
FT   CDS_pept        38962..39903
FT                   /locus_tag="Alide_0031"
FT                   /gene_family="HOG000117544" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04381"
FT                   /codon_start="1"
FT                   /product="exonuclease rdgc"
FT                   /transl_table="11"
FT                   /note="PFAM: exonuclease RdgC; KEGG: ajs:Ajs_0008
FT                   recombination associated protein"
FT                   /db_xref="GI:319760769"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="GeneID:10102054"
FT                   /translation="MFKNIIVYRIAPEWHAELTQLEEALAKAPFQECGATQEKSSGWVP
FT                   PRGEAHGLLAESVGGQWILRFMTESKMLPGTVLARKVKEKAAQIEQQTGRKPGKKETRE
FT                   LKDEAKLDLLPMAFTKQGSTWVWVDCEARLLVLDTGVQGRADEIVTALVEALPGLSVAL
FT                   VDTQTSPQAAMAHWLKEQEPPAGFSIDRECELKAADESKAVVRYARHPLDIEEVQAHIQ
FT                   AGKLPTKLAMTWDDRVSFVLTEGLQLKKLAFLDTVFEGQPQDDGGFDADVAIATGELSK
FT                   LIPDLIEALGGEGRTELGSPAQPPQDDGGAPF"
FT                   /protein_id="YP_004124706.1"
     GTGTTCAAGA ACATCATCGT GTACCGCATC GCCCCCGAGT GGCATGCAGA GCTGACCCAG        60
     CTGGAGGAGG CTCTGGCCAA GGCACCGTTC CAAGAATGCG GCGCGACGCA GGAAAAGTCC       120
     AGCGGCTGGG TGCCGCCGCG CGGCGAGGCC CATGGCCTGC TGGCCGAGAG TGTGGGCGGG       180
     CAGTGGATCC TGCGCTTCAT GACCGAGTCC AAGATGCTGC CGGGCACGGT GCTGGCGCGC       240
     AAGGTCAAGG AGAAGGCCGC GCAGATCGAG CAGCAGACCG GCCGCAAGCC CGGCAAGAAG       300
     GAAACGCGCG AGCTGAAGGA CGAGGCCAAG CTCGACCTGC TGCCCATGGC CTTCACCAAG       360
     CAGGGATCGA CCTGGGTGTG GGTGGACTGC GAGGCGCGGC TGCTGGTGCT GGACACGGGC       420
     GTCCAGGGCC GTGCCGACGA GATCGTCACG GCCCTGGTCG AGGCGCTGCC GGGCCTGTCG       480
     GTCGCGCTCG TCGATACGCA AACCAGCCCG CAGGCCGCCA TGGCCCACTG GCTCAAGGAG       540
     CAGGAGCCGC CCGCGGGCTT CTCCATCGAC CGCGAATGCG AGCTCAAGGC CGCGGACGAG       600
     AGCAAGGCCG TGGTGCGCTA CGCGCGCCAC CCGCTGGACA TCGAGGAAGT GCAGGCCCAC       660
     ATCCAGGCCG GCAAGCTGCC CACCAAGCTG GCCATGACCT GGGACGACCG CGTGAGCTTC       720
     GTGCTCACCG AGGGGCTGCA GCTCAAGAAG TTGGCCTTCC TGGACACGGT GTTCGAGGGC       780
     CAGCCGCAGG ACGATGGCGG CTTCGACGCC GACGTGGCCA TCGCCACGGG TGAGCTCTCC       840
     AAGCTCATCC CCGACCTGAT CGAAGCGCTG GGCGGGGAAG GGCGCACCGA GCTGGGCTCA       900
     CCCGCACAGC CCCCGCAGGA CGACGGCGGC GCGCCTTTCT AG                          942
//

If you have problems or comments...

PBIL Back to PBIL home page