(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE310

ALDEN1_2.PE310       Location/Qualifiers
FT   CDS_pept        348931..349596
FT                   /locus_tag="Alide_0316"
FT                   /gene_family="HOG000154776" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0215 transcriptional regulator, AraC
FT                   family; PFAM: Cupin 2 conserved barrel domain protein;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:319761048"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="GeneID:10102339"
FT                   /translation="MPSLVHPVASVRRYAGEHQAHAHEHAQVLYALEGRMELEVAGRAA
FT                   FVDTACGLVVPAGVEHGFLARPGTRMFVIDAPPQAGVDRVRRFAVPPGARPADAAGQLA
FT                   LLLHAPRVLARRGMDLALLQSRVDAALHEPWPTARMAALFHLSAPRFHARLVELTGRTP
FT                   QAWLRARRLDAAERALARGLPLEATALRVGYASASALAYALRRERGTGARALRGFQAK"
FT                   /protein_id="YP_004124985.1"
     ATGCCTTCGC TCGTCCACCC CGTCGCCTCG GTGCGCCGCT ACGCTGGCGA GCACCAGGCG        60
     CACGCGCACG AGCACGCGCA GGTCCTCTAC GCGCTCGAAG GCCGCATGGA GCTGGAGGTG       120
     GCGGGCCGCG CCGCGTTCGT GGACACGGCC TGCGGCCTCG TCGTGCCCGC GGGCGTGGAG       180
     CACGGCTTTC TCGCGCGGCC CGGCACGCGC ATGTTCGTGA TCGACGCGCC GCCGCAGGCG       240
     GGCGTGGACC GCGTGCGCCG CTTCGCCGTG CCGCCGGGCG CGCGTCCCGC CGATGCGGCC       300
     GGCCAGCTCG CGCTGCTGCT GCACGCGCCG CGCGTGCTGG CGCGCCGGGG CATGGACCTG       360
     GCGCTGCTGC AGTCGCGCGT GGATGCGGCG CTGCACGAGC CCTGGCCCAC GGCGCGCATG       420
     GCAGCGCTCT TTCACCTGAG CGCGCCGCGC TTTCACGCGC GGCTGGTGGA GCTCACGGGC       480
     CGCACGCCCC AGGCGTGGCT GCGCGCGCGC CGGCTCGACG CGGCCGAGCG CGCGCTGGCG       540
     CGCGGCCTGC CGCTGGAGGC CACGGCCCTG CGCGTGGGCT ACGCCAGTGC CAGCGCGCTG       600
     GCCTACGCCT TGCGGCGCGA GCGCGGCACG GGCGCGCGGG CGCTGCGCGG GTTTCAAGCA       660
     AAATAG                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page