(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE311

ALDEN1_2.PE311       Location/Qualifiers
FT   CDS_pept        349710..350603
FT                   /locus_tag="Alide_0317"
FT                   /gene_family="HOG000253119" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ajs:Ajs_0201 hypothetical protein"
FT                   /db_xref="GI:319761049"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="GeneID:10102340"
FT                   /translation="MNTASLRSIAMVLLAAMLWGTTGTAQSLAPATLSPYWVGALRLGF
FT                   ASAFFAVLAWPALRRGAWRGLRGAALPLAALCVAAYNLSFFAGVKASGVALGTALAIGS
FT                   GPVWAGLLQTVAQRRWPAPAWWLGTLLGVAGGVAMALDGGADARAPLSGIALCLLAGLS
FT                   YAGYALLNKRLVARAGPAMVNLAVFGGAGLLSLPVALLLGGVPTPSAATWGVVLYLGLA
FT                   ATGLAYLLFSAALRHISGATGVTLALAEPVTAFALAILVVGERPSAMAFWGLGGVLAGL
FT                   LLVIWSELRAAPKLGA"
FT                   /protein_id="YP_004124986.1"
     ATGAATACCG CATCCCTGCG CAGCATCGCC ATGGTGCTGC TTGCCGCCAT GCTCTGGGGC        60
     ACCACCGGCA CCGCGCAAAG CCTGGCGCCC GCCACGCTGT CGCCCTACTG GGTGGGCGCG       120
     CTGCGCCTGG GCTTTGCCAG CGCCTTCTTC GCCGTGCTGG CCTGGCCGGC CCTGCGCCGC       180
     GGCGCGTGGC GCGGCCTGCG CGGCGCCGCG CTGCCGCTGG CCGCGCTGTG CGTGGCGGCG       240
     TACAACCTGA GCTTCTTCGC GGGGGTGAAG GCCAGCGGCG TGGCGCTGGG CACGGCGCTG       300
     GCCATCGGCA GCGGGCCGGT CTGGGCCGGG CTGCTGCAGA CCGTGGCGCA GCGGCGCTGG       360
     CCCGCGCCCG CGTGGTGGCT GGGCACGCTG CTGGGCGTGG CGGGCGGGGT GGCCATGGCG       420
     CTGGATGGCG GCGCCGACGC GCGCGCGCCG CTTTCGGGCA TCGCGCTGTG CCTGCTGGCC       480
     GGGCTGTCGT ATGCGGGCTA TGCACTCTTG AACAAGCGCC TGGTGGCGCG GGCCGGCCCC       540
     GCCATGGTGA ACCTGGCGGT GTTCGGCGGC GCGGGCCTGC TGTCGCTGCC CGTGGCGCTG       600
     CTGCTGGGCG GCGTGCCCAC GCCGTCGGCG GCCACCTGGG GCGTGGTGCT GTACCTGGGG       660
     CTGGCGGCCA CGGGGCTGGC CTACCTGCTG TTCAGCGCGG CGCTGCGCCA CATCAGCGGC       720
     GCCACGGGCG TCACGCTGGC GCTGGCCGAG CCGGTGACGG CGTTCGCGCT GGCCATCTTG       780
     GTGGTGGGCG AGCGGCCCTC GGCCATGGCC TTCTGGGGCC TGGGGGGAGT GCTGGCGGGG       840
     CTGCTGCTGG TGATCTGGTC GGAGTTGCGC GCGGCGCCTA AACTTGGCGC ATGA             894
//

If you have problems or comments...

PBIL Back to PBIL home page