(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE313

ALDEN1_2.PE313       Location/Qualifiers
FT   CDS_pept        complement(352011..352766)
FT                   /locus_tag="Alide_0321"
FT                   /gene_family="HOG000273992" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /codon_start="1"
FT                   /product="regulatory protein gntr hth"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0204 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH"
FT                   /db_xref="GI:319761051"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="GeneID:10102344"
FT                   /translation="MAKRSALYAIAAPAPSSARTLIEHAYARLRDDIVSGQLVPGEKLR
FT                   VEHLKERYGVSAGTLREAITRLASDALVVTEGQRGFRVAPITTEDLEDITNLRVQIETE
FT                   ALRQSIRAGDAQWRQRVEQAFAAISAEEPIAPGRRHAWEQLNTRFHEALLSGHASPWTV
FT                   HVLRLLSRHTERYRSFAMALPGCVRDVHAEHTAIFEYTMAGQDARAALALEAHIRTTPD
FT                   LLIQALREGRASLPGSAAPLLEGKGLQDS"
FT                   /protein_id="YP_004124988.1"
     atggccaagc gcagcgccct gtacgcgatc gccgcccccg cgccgtcgtc ggcgcgcacc        60
     ctgatcgagc acgcctacgc gcggctgcgc gacgacatcg tgagcggcca gctcgtgccc       120
     ggcgagaagc tgcgcgtgga gcacctcaag gagcgctacg gcgtgagcgc cggcacgctg       180
     cgcgaggcca tcacgcgcct ggccagcgac gcgctggtgg tgaccgaggg acaacgcggc       240
     tttcgcgtgg cgcccatcac caccgaggac ctggaggaca tcaccaacct gcgcgtgcag       300
     atcgagactg aggcgctgcg ccagtcgatc cgcgcgggcg acgcgcagtg gcgccagcgc       360
     gtggagcagg ccttcgccgc catctcggcc gaagagccca tcgcgcccgg gcggcggcac       420
     gcgtgggagc agctcaacac gcgcttccac gaggcgctgc tgtcgggcca cgcctcgccc       480
     tggacggtgc acgtgctgcg cctgctctcg cgccacaccg agcgctaccg cagcttcgcc       540
     atggcgctgc ccggctgcgt gcgcgacgtg cacgccgagc acaccgcgat cttcgaatac       600
     accatggccg ggcaggacgc gcgcgccgcg ctggcgctgg aggcgcacat ccgcaccacg       660
     ccggacctgc tgatccaggc gctgcgcgag ggccgcgcat cgctgcccgg cagcgccgcg       720
     ccgctgctgg agggcaaggg cctgcaggat tcatag                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page