(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE314

ALDEN1_2.PE314       Location/Qualifiers
FT   CDS_pept        complement(352768..354474)
FT                   /locus_tag="Alide_0322"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /codon_start="1"
FT                   /product="sigma-54 factor interaction domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: lch:Lcho_3364 sigma54 specific transcriptional
FT                   regulator; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; Activator of aromatic
FT                   catabolism; 4-vinyl reductase 4VR; helix-turn-helix
FT                   Fis-type; SMART: AAA ATPase"
FT                   /db_xref="GI:319761052"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008134"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR020441"
FT                   /db_xref="GeneID:10102345"
FT                   /translation="MPTLPALPSDADLRRQIQFSAADGRIWLAGQRMVLMHAASLGILR
FT                   RELIHTLGPAATRRLLLRVGYASGERDAALARQLRPGADAFAMFSVGPQLHMLQGAVQV
FT                   TPEKLELDAATGHFHGIFAWQQSWEVEVHVRDFGPQNVPVCWMLLGYASGYTSAFMGRT
FT                   VLYKEVQCAASGHAHCRIEGRPVQDWPDGAQLAADYAPDALLDDGAPQNGPRALPAWPA
FT                   PMPAEDRPEPPADALGPLIGRSAGFTAATRLLRKAAGTQVTVLLTGETGVGKERFARAL
FT                   HALSPRAAKPFVAVNCAALPGNLVESELFGTEKGAYTGADAARAGRFERAHGGTLFLDE
FT                   LGELPLSAQAKLLRVLQDGQVERLGATQPRQVDVRLVAATHVDLQDAVRAGRFRQDLYY
FT                   RLNVYPIRIPPLRERQDDIEPFARHLLQRFAALHDKHIGGLTDRALHALRQYAWPGNVR
FT                   EMENLIERGVILADPGQPVDAAHLFPDSAPAAAPAHTLQASGRLGEARAPACDAALIDR
FT                   LLGERLDLQALETHLIEAAVERSHGNLAAAARLLGLTRPQLSYRLNKVRDI"
FT                   /protein_id="YP_004124989.1"
     atgcccaccc ttcccgcgct gccctccgac gccgacctgc ggcgccagat ccagttctcg        60
     gcagccgacg ggcgcatctg gctggcgggc cagcgcatgg tgctgatgca cgccgcgtcg       120
     ctgggcatac tgcgccgcga gctgatacac acgctcggcc ccgccgccac gcgccgtctg       180
     ctgctgcgcg tgggctacgc ctcgggcgag cgcgacgcgg cgctggcgcg ccagctgcgc       240
     cccggcgccg acgccttcgc catgttcagc gtgggcccgc agctgcacat gctgcagggg       300
     gccgtgcagg tcacccccga aaagctggag ctggacgcgg cgaccggcca cttccacggc       360
     atctttgcct ggcaacagtc gtgggaggtg gaagtccacg tgcgcgactt cggcccgcag       420
     aacgtccccg tgtgctggat gctgctgggc tacgcctcgg gctacaccag tgccttcatg       480
     ggccgcaccg tgctctacaa ggaggtgcag tgcgccgcca gcggccacgc gcactgccgc       540
     atcgagggcc gcccggtgca ggactggccc gacggcgcgc agctggccgc cgactacgcg       600
     cccgacgcgc tgctggacga cggcgcgccc cagaacggcc cgcgcgccct gcccgcctgg       660
     cccgcgccca tgcccgccga ggaccggccc gagccgcccg ccgacgcgct gggcccgctg       720
     atcgggcgct cggccggctt caccgccgcc acgcggctgc tgcgcaaggc cgcgggcacg       780
     caggtcacgg tgctgctcac gggcgagacc ggcgtgggca aggagcgctt cgcgcgcgcc       840
     ctgcacgctt taagcccgcg cgcggccaag cctttcgtgg cggtgaactg cgcggcgctg       900
     ccgggcaacc tggtcgagtc cgagctcttc ggcaccgaga agggcgccta taccggcgcc       960
     gacgcggcgc gcgccgggcg cttcgagcgc gcgcacggcg gtacgctgtt cctcgacgag      1020
     ctgggcgaac tgccgctgtc cgcgcaggcc aagctgctgc gcgtgctgca ggacgggcag      1080
     gtcgagcgcc tgggcgccac ccagccgcgc caggtggacg tgcgcctggt ggccgccacg      1140
     cacgtggacc tgcaggacgc ggtgcgcgcc gggcgcttcc gccaggacct gtactaccgc      1200
     ctgaacgtct accccatccg catcccgccg ctgcgcgagc gccaggacga catcgagccc      1260
     ttcgcgcggc acctgctgca gcgcttcgcg gcgctgcacg ataagcacat cggcggcctc      1320
     acggaccgcg cgctgcacgc gctgcgccag tacgcctggc cggggaacgt gcgcgagatg      1380
     gagaacctga tcgagcgcgg cgtgatcctg gccgacccgg gccagcccgt ggacgcggcg      1440
     cacctctttc ccgacagcgc cccggcggcc gcgcccgcgc acacgctgca ggcctcgggc      1500
     cgcctgggcg aggcccgtgc cccggcctgc gacgcggcgc tgatcgaccg cctgctgggc      1560
     gagcgcctgg acctgcaggc gctggagacc cacttgatcg aggccgccgt ggaacgcagc      1620
     cacggcaacc tggcggcggc cgcgcgcctg ctgggcctga cgcgcccgca gctgagctac      1680
     cggctgaaca aggtacggga tatctga                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page