(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE315

ALDEN1_2.PE315       Location/Qualifiers
FT   CDS_pept        354706..355017
FT                   /locus_tag="Alide_0323"
FT                   /gene_family="HOG000219895" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06099"
FT                   /codon_start="1"
FT                   /product="phenol hydroxylase subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Phenol hydroxylase subunit; KEGG:
FT                   avn:Avin_30760 multi-component phenol hydoxylase, assembly
FT                   subunit; LapK"
FT                   /db_xref="GI:319761053"
FT                   /db_xref="InterPro:IPR010353"
FT                   /db_xref="GeneID:10102346"
FT                   /translation="MSCIGLGMRTTPPSSNDRWDLQRRYIRIVQEHGNGMVEFEFAVGE
FT                   PQLYVEMVMPRAQFDDFCATQGVQPTVGRLPGQEQGSAEHEWDWNLRDARERHFRHEP"
FT                   /protein_id="YP_004124990.1"
     ATGTCCTGCA TAGGCCTGGG CATGCGCACC ACGCCACCTT CCTCCAACGA CCGCTGGGAT        60
     CTCCAGCGCC GCTACATCCG CATCGTGCAG GAGCACGGCA ACGGCATGGT GGAGTTCGAG       120
     TTCGCCGTGG GCGAGCCGCA GCTCTACGTC GAGATGGTGA TGCCGCGCGC GCAGTTCGAC       180
     GACTTCTGCG CCACGCAGGG CGTGCAGCCC ACCGTCGGGC GCCTGCCGGG GCAGGAGCAG       240
     GGCAGCGCCG AGCACGAATG GGACTGGAAC CTGCGCGACG CGCGCGAGCG CCACTTCCGC       300
     CACGAGCCCT GA                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page