(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE316

ALDEN1_2.PE316       Location/Qualifiers
FT   CDS_pept        355061..356053
FT                   /locus_tag="Alide_0324"
FT                   /gene_family="HOG000219896" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.14.13.7"
FT                   /codon_start="1"
FT                   /EC_number="1.14.13.7"
FT                   /transl_table="11"
FT                   /note="KEGG: azo:azo2443 phenol hydroxylase, subunit P1;
FT                   PFAM: methane/phenol/toluene hydroxylase"
FT                   /db_xref="GI:319761054"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR012078"
FT                   /db_xref="GeneID:10102347"
FT                   /translation="MQIDLRTVSITPLRQTYDHIARRLGADKPASRYIEATMDVQPQAN
FT                   FHYRPTWDPEHELFDASRTRIVMQDWYALKDPRQLYYGTYAQARARLQEVAEADFEFVE
FT                   SRGLAERFDDTARRTALDFYVPLRHVAWGANMNGAYQCAYGHGTAITQPCLYAGMDQLG
FT                   IAQYLTRLGLLLGNQGDLEAGKQAWLEAPAWQGLRRVVEDTWVLKDWFELYVAQNVVLD
FT                   GILFGLAYREVDAALSEQAGPTVSMLTRFQAEWFQDANKWVDAVIKTAAAESADNQALL
FT                   GQWYAHWRGRVQEALAPVARLALGDAGDAALARAVAAVDARMHKSGLAV"
FT                   /product="phenol 2-monooxygenase"
FT                   /protein_id="YP_004124991.1"
     ATGCAAATCG ACCTGCGCAC CGTCAGCATC ACGCCGCTGC GCCAGACCTA CGACCACATC        60
     GCCCGGCGGC TGGGCGCGGA CAAGCCGGCC TCGCGCTACA TCGAGGCCAC GATGGACGTG       120
     CAGCCCCAGG CCAACTTCCA CTACCGCCCC ACCTGGGACC CGGAGCACGA GCTGTTCGAC       180
     GCCTCGCGCA CCCGCATCGT GATGCAGGAC TGGTACGCGC TGAAAGACCC GCGCCAGCTC       240
     TATTACGGCA CCTACGCCCA GGCGCGCGCC CGCCTGCAGG AGGTGGCCGA GGCGGACTTC       300
     GAGTTCGTCG AGTCGCGCGG CCTGGCCGAG CGCTTCGACG ACACGGCGCG GCGTACGGCG       360
     CTGGACTTCT ACGTGCCGCT GCGCCACGTG GCCTGGGGCG CGAACATGAA CGGCGCCTAC       420
     CAGTGCGCCT ACGGGCACGG CACGGCCATC ACCCAGCCCT GCCTGTACGC CGGCATGGAC       480
     CAGCTCGGTA TCGCCCAGTA CCTCACGCGC CTGGGCCTGC TGCTGGGCAA CCAGGGCGAC       540
     CTGGAGGCGG GCAAGCAGGC CTGGCTGGAG GCGCCCGCCT GGCAGGGCCT GCGCCGCGTG       600
     GTGGAGGACA CCTGGGTGCT CAAGGACTGG TTCGAGCTGT ACGTGGCGCA GAACGTGGTG       660
     CTGGACGGCA TCCTGTTCGG CCTGGCCTAC CGCGAGGTGG ACGCCGCGCT GTCCGAGCAG       720
     GCCGGCCCCA CGGTGTCCAT GCTCACGCGC TTCCAGGCCG AGTGGTTCCA GGACGCGAAC       780
     AAGTGGGTGG ACGCCGTCAT CAAGACCGCC GCTGCCGAAA GCGCAGACAA CCAGGCCCTG       840
     CTGGGCCAGT GGTACGCCCA CTGGCGCGGC CGCGTGCAGG AGGCGCTGGC GCCGGTGGCG       900
     CGACTGGCGC TGGGCGACGC GGGCGATGCC GCCCTGGCGC GCGCCGTGGC CGCCGTCGAT       960
     GCGCGCATGC ACAAGTCCGG CCTGGCCGTC TGA                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page