(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE317

ALDEN1_2.PE317       Location/Qualifiers
FT   CDS_pept        356076..356345
FT                   /locus_tag="Alide_0325"
FT                   /gene_family="HOG000219897" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02406"
FT                   /codon_start="1"
FT                   /product="monooxygenase component mmob/dmpm"
FT                   /transl_table="11"
FT                   /note="PFAM: monooxygenase component MmoB/DmpM; KEGG:
FT                   azo:azo2442 phenol hydrolase, subunit P2"
FT                   /db_xref="GI:319761055"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="InterPro:IPR003454"
FT                   /db_xref="GeneID:10102348"
FT                   /translation="MSNVFIAFQKNEETRAIVDAIVADNPQAIVNQQPAMVKIDAPGRL
FT                   VIRKSSIEQEIGREFDLQEMHVHLITLSGNIDETDDELSLTWNQ"
FT                   /protein_id="YP_004124992.1"
     ATGTCCAACG TATTCATCGC CTTCCAGAAG AACGAGGAAA CGCGCGCCAT CGTCGACGCC        60
     ATCGTCGCCG ACAACCCGCA GGCCATCGTC AACCAGCAGC CCGCCATGGT GAAGATCGAC       120
     GCCCCGGGCC GCCTGGTGAT CCGCAAGAGC AGCATCGAGC AGGAGATCGG GCGCGAGTTC       180
     GACCTGCAGG AGATGCACGT GCACCTCATC ACCCTGTCGG GAAACATCGA CGAGACCGAC       240
     GACGAGCTCA GCCTGACCTG GAATCAGTGA                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page