(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE318

ALDEN1_2.PE318       Location/Qualifiers
FT   CDS_pept        356371..357918
FT                   /locus_tag="Alide_0326"
FT                   /gene_family="HOG000219898" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02332"
FT                   /codon_start="1"
FT                   /product="methane/phenol/toluene hydroxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: methane/phenol/toluene hydroxylase; YHS
FT                   domain-containing protein; KEGG: azo:azo2441 phenol
FT                   hydroxylase, subunit P3"
FT                   /db_xref="GI:319761056"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="GeneID:10102349"
FT                   /translation="MDRQVSKKLGLKERYNLMTRDLAWTPTYQALKDVFPYMEYEGIKI
FT                   HDWDKFEDPFRMTMDSYWKYQAEKERKLYAIIDAFTQNNGHLGVTDARYINALKLFLTG
FT                   VSPLEYMAHRGFAHVGRQYPGAGPRVACLMQSLDEIRHSQTQIHSLSNYNKHYNGFANW
FT                   RHQHDRVWYLSVPKSFFDDAVSAGPFEFIVAIGFAFEYVLTNLLFVPFISGAAYNGDMG
FT                   AMAFGFSAQSDESRHMTLGLEIIKFILEQDPDNLPIVQAWLDKWFWRGYRVLTLVAMMM
FT                   DYMLPKRVMSWKEAWETYAEQNGGALFADLARYGIKVPAGWEQACKDKDHLSHQAWNVF
FT                   YNYGAAAPFHTWAPSEADMKWLSEKYPDTFDKYYRPVWEHYAKEQAEGRRFYNKTLPML
FT                   CQTCQIPMFFTEPGDPTKIAYRESDWRGQKYHFCSDGCKHIFDNEPEKYVQSWLPVHQI
FT                   YQGNCFPEDADPSKPDFDPLMEVLRWYRMEFGRDNLDYADSEDKKNFEAWRAQSTSN"
FT                   /protein_id="YP_004124993.1"
     ATGGATAGAC AAGTCAGCAA GAAGCTGGGC CTGAAAGAGC GCTACAACCT CATGACGCGC        60
     GACCTGGCCT GGACGCCCAC CTACCAGGCG TTGAAGGACG TGTTCCCGTA CATGGAGTAC       120
     GAGGGCATCA AGATCCACGA CTGGGACAAG TTCGAGGACC CGTTCCGCAT GACCATGGAC       180
     TCGTACTGGA AGTACCAGGC CGAGAAGGAG CGCAAGCTCT ACGCCATCAT CGACGCCTTC       240
     ACGCAGAACA ACGGCCACCT GGGCGTGACG GACGCGCGCT ACATCAACGC GCTCAAGCTG       300
     TTCCTCACCG GCGTCAGCCC GCTGGAATAC ATGGCGCACC GGGGCTTCGC CCACGTCGGC       360
     CGCCAGTACC CCGGCGCCGG CCCGCGCGTG GCCTGCCTGA TGCAGAGCCT GGACGAGATC       420
     CGCCACTCGC AGACGCAGAT CCACTCGCTG TCCAACTACA ACAAGCACTA CAACGGCTTC       480
     GCCAACTGGC GCCACCAGCA CGACCGCGTG TGGTACCTCA GCGTGCCCAA GAGCTTCTTC       540
     GACGACGCCG TGAGCGCCGG GCCGTTCGAG TTCATCGTGG CCATCGGCTT CGCGTTCGAA       600
     TACGTGCTCA CCAACCTGCT GTTCGTGCCC TTCATCAGCG GCGCGGCCTA CAACGGCGAC       660
     ATGGGCGCCA TGGCGTTCGG TTTCTCGGCG CAGTCCGACG AGTCGCGCCA CATGACGCTG       720
     GGGCTGGAGA TCATCAAGTT CATCCTGGAG CAGGACCCGG ACAACCTGCC CATCGTGCAG       780
     GCCTGGCTGG ACAAGTGGTT CTGGCGCGGC TACCGCGTGC TCACGCTGGT GGCCATGATG       840
     ATGGACTACA TGCTGCCCAA GCGCGTGATG AGCTGGAAGG AAGCCTGGGA GACCTACGCC       900
     GAGCAAAACG GCGGCGCCCT GTTCGCCGAC CTGGCGCGCT ACGGCATCAA GGTGCCCGCC       960
     GGCTGGGAAC AGGCCTGCAA GGACAAGGAC CACCTGAGCC ACCAGGCCTG GAACGTGTTC      1020
     TACAACTACG GCGCCGCGGC CCCCTTCCAC ACCTGGGCGC CGAGCGAGGC CGACATGAAG      1080
     TGGCTGAGCG AGAAGTACCC CGACACCTTC GACAAGTACT ACCGCCCGGT GTGGGAGCAC      1140
     TACGCCAAGG AGCAGGCCGA GGGCCGGCGC TTCTACAACA AGACGCTGCC CATGCTGTGC      1200
     CAGACCTGCC AGATCCCGAT GTTCTTCACC GAACCGGGCG ACCCGACCAA GATCGCCTAC      1260
     CGCGAGAGCG ACTGGCGTGG CCAGAAATAC CACTTCTGCT CCGACGGCTG CAAGCACATC      1320
     TTCGACAACG AGCCCGAGAA GTACGTGCAA AGCTGGCTGC CCGTGCACCA GATCTACCAG      1380
     GGCAACTGCT TCCCCGAGGA CGCCGACCCG TCCAAGCCCG ACTTCGACCC GCTGATGGAG      1440
     GTGCTGCGCT GGTACCGCAT GGAGTTCGGG CGCGACAACC TGGACTACGC CGACTCCGAG      1500
     GACAAGAAGA ACTTCGAGGC CTGGCGCGCG CAGTCCACCA GCAACTGA                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page